KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3326
Entry
ECED1_3326        CDS       T00827                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00230  Purine metabolism
ecq01100  Metabolic pathways
ecq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECED1_3326 (xdhA)
Enzymes [BR:ecq01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ECED1_3326 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C DUF4694
Other DBs
NCBI-ProteinID: CAR09484
UniProt: B7MZG6
Position
3266036..3268294
AA seq 752 aa
MRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQARSLPGVLAIFTWE
DVPEIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARDELTAEKAAQLVSI
EWQELPVITSPEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAADYQVQGHYQTPVIQ
HCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVRVIKPFIGGGFGNK
QDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMGVNRDGTLKGYSLD
VLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAGAMRGYGAPQVVFA
VESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECLEKGRKIFEWEKRR
AECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINVQSGATEIGQGADT
VFSQMVAETVGVPVSDVHVISTQDTDVTPFDPGAFASRQSYVAAPALRSAALLLKEKIIA
HAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERGGQLSAESSIKTTT
NPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHGGMGMGIGWALFEE
MIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKSLGEPPIIPVAAAI
RNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgcgcgtcgatgccattgctaaggtcaccgggcgagcacgatatactgacgattatgtt
atggcgggcatgtgttacgcgaaatatgtacgtagccctatcgcacatggttatgccgta
agtattaatgatgaacaagccaggagtttgccgggcgtcctggcgatttttacctgggaa
gatgtgccagaaatcccattcgccacggcagggcatgcctggacacttgacgaaaacaag
cgcgataccgccgatcgtgccctgctaacgcgccatgttcgtcatcatggcgacgccgtt
gccatcgtcgtggcccgcgatgaactcacggcagaaaaagcggcgcaattggtcagcatt
gagtggcaagaattacccgttatcacctcgccagaagcggcgctggcagaagacgctgca
ccaatccataacggtggcaatttactgaaacaaagcacgatgtcgacgggtaatgtccaa
caaacaatcgatgccgccgactaccaggtacaggggcactatcagactcccgttattcaa
cattgtcatatggaaagcgtgacatcgctggcatggatggaggatgactcgcgaattacc
atcgtttccagcacccagatcccgcacattgttcgccgcgtggttggtcaggcgctggat
attccctggtcatgcgtacgagtcatcaaaccgtttatcggtggcggttttggtaataaa
caggatgtactggaagagccaatggcggcattcctgaccagcaaacttggcggcattccg
gtgaaagtttcccttagccgtgaagagtgtttcctcgcaacccgtacccgccacgctttt
actattgacgggcaaatgggcgtgaaccgcgacggaacattgaaaggttatagtctggat
gttctgtctaacaccggcgcttatgcatctcacgggcactccattgcttctgctgggggg
aataaagtcgcttacctttatcctcgttgtgcctacgcttacagttcaaagacctgctat
accaacctcccctcggctggtgcgatgcgtggttatggcgcgccacaagtcgtatttgcc
gttgagtctatgcttgatgatgccgcgacagcgttaggtattgatcctgttgaaattcgt
ttacgcaacgccgcccgcgaaggagatgctaatccgctcacgggaaaacgtatttacagc
gcagggttgccggagtgtcttgaaaaaggccggaaaatctttgaatgggaaaaacgccgt
gcagagtgccagaaccagcaaggcaatttacgtcgtggcgttggcgtcgcctgttttagc
tacacctctaacacctggcctgtcggcgtagaaatagcaggcgcgcgcctgttgatgaat
caggatggaaccatcaacgtgcaaagcggcgcgacggaaatcggccagggtgccgacacc
gtgttctcgcaaatggtggcagaaaccgtgggagttccggtcagcgatgttcacgttatt
tcaacccaagacaccgacgttacaccattcgaccccggcgcatttgcctcacgtcagagc
tatgttgccgcgcctgcgctgcgcagtgcggcactgttattaaaagagaaaatcatcgct
cacgccgcagtcatgctacatcagtcagcgatgaatctgaccctgataaaaggccatatc
gtgctggttgaacgaccggaagagccgttaatgtcgttaaaagatttggcgatggacgct
ttctaccaccctgaacgcggcgggcagctctctgccgaaagctccatcaaaaccaccact
aacccaccggcgtttggctgtacctttgttgatctgacggtcgatattgcactgtgtaaa
gtcaccatcaaccgcatcctcaacgttcatgattcgggccatattcttaatccgctgctg
gcagaaggtcaggtacacggcggaatgggaatgggcattggctgggcgctatttgaagag
atgatcatcgatgcgaaaagcggcgtggtccgtaaccccaatctgctggattacaaaatg
ccgaccatgccggatctgccacaactggaaagcgcgttcgtcgaaatcaatgagccgcaa
tccgcatacggacataagtcactgggtgagccacccataattcctgtagccgctgctatt
cgtaacgcggtgaagatggctaccggtgttgcaatcaatacactgccgctaacgccaaaa
cgattatatgaagaattccatctggcaggattgatttga

DBGET integrated database retrieval system