KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3328
Entry
ECED1_3328        CDS       T00827                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase, Fe-S binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00230  Purine metabolism
ecq01100  Metabolic pathways
ecq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECED1_3328 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: CAR09339
UniProt: B7MZ22
Position
3269180..3269659
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLFLAAWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcgccaggaatgccgctttcggaactactccgagaacaagggcttcttagtgtc
aaacaaggttgctgcgtaggcgaatgcggtgcctgtacggtgctggtcgacggcactgcg
atagacagttgcttattccttgcggcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggtaaactttctcatgtccaactggcttatgcgaaatccggcgca
gtgcaatgcgggttttgtacgccgggcctgattatggctaccacggcgatgctggcaaaa
ccacgcgaaaaaccattaaccattacggaaattcgtcgtggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system