KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3369Help
Entry
ECED1_3369        CDS       T00827                                 

Gene name
zapA
Definition
(GenBank) protein that localizes to the cytokinetic ring
  KO
K09888  cell division protein ZapA
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecq03036]
    ECED1_3369 (zapA)
Chromosome and associated proteins [BR:ecq03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    ECED1_3369 (zapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZapA DUF3482 Bac_rhamnosid6H PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: CAR09525
UniProt: B7MZK7
Structure
PDB: 

Position
3320103..3320432
Genome map
AA seq 109 aa AA seqDB search
MSAQPVDIQIFGRSLRVNCPPDQRDALNQAADDLNQRLQDLKERTRVTNTEQLVFIAALN
ISYELAQEKAKTRDYAASMEQRIRMLQQTIEQALLEQGRITEKTNQNFE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacaacccgtcgatatccaaatttttggccgttcactgcgtgtgaactgcccg
cctgaccaaagggatgcgttgaatcaggcagcggacgatctgaaccaacggttgcaagat
ctgaaagaacgcactagagtcacaaatactgaacagttggtcttcattgccgcattgaat
atcagctatgagttagcgcaagaaaaagcgaagactcgtgactacgcggcaagtatggaa
cagcgtattcggatgctgcagcagaccatagaacaagcgttacttgaacaaggtcgcatc
accgaaaaaactaaccaaaactttgaatga

DBGET integrated database retrieval system