KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3558Help
Entry
ECED1_3558        CDS       T00827                                 

Definition
(GenBank) conserved hypothetical protein; putative exported protein
Organism
ecq  Escherichia coli O81 ED1a (commensal)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1525
Motif
Other DBs
NCBI-ProteinID: CAR09564
UniProt: B7MZP6
Position
complement(3484380..3484778)
Genome map
AA seq 132 aa AA seqDB search
MHRIIFSSLFFLPTAVSAGITLYTDSQHPPVNPPSDVRVILLDGPEQLQARFFGALPADA
GEAEERVRARMQSPEWGAMQAELAERYREVAHAWSLGVKKYPAVVFDDRDVVYGTTDVAE
AAQLRAQEGVQP
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgcaccggattatattcagttccctgtttttcctgccgacggcggtatcagccggcata
accctttataccgattctcaacatcctcctgtaaacccgccttcagacgtgcgggtgatc
cttctggatggtcctgaacaactgcaggctcgtttttttggtgcattgcccgccgatgcc
ggtgaggccgaagaaagggtcagagcgcgtatgcagtccccggagtggggggcgatgcag
gcggagttggctgagcgttaccgggaggtggcgcatgcatggtcactgggcgtgaagaaa
tatccggccgtggtctttgatgatcgtgacgtggtctacggtaccacggatgtggcagag
gccgcacaactgagagcacaggaaggagttcagccatga

DBGET integrated database retrieval system