KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3562
Entry
ECED1_3562        CDS       T00827                                 
Name
(GenBank) putative plasmid-related outer membrane ATPase
Organism
ecq  Escherichia coli O81 ED1a (commensal)
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 Arr-ms AAA_29 T2SSE
Other DBs
NCBI-ProteinID: CAR09714
UniProt: B7N046
Position
complement(3487870..3490686)
AA seq 938 aa
MAFTLFKRRNVTTPSETEAAGQGFVPPVPPGAQPLKRPGQMTQEEEARVYHAGPSVIDFL
PWVEYLDEAQCLLLDDGMSVGAVYDVTPAATEGRTDERLEQIRDMVEDALQDSFDEYDTH
PWVVQFFCQDENDVDAYLDYLKGYVKPHAQGTAFTEAWLGEMERHLRGIARPEGLFTDTL
VTGQPWRGQQRRTRMVIYRRIAKNNSDPMPPVAMLNQVCDRVVSALGSAGVRCHRMNGLQ
VHSWLLRLFNPAPSWISREDLYRMASRADPRENDADVMPVMTDFAESLWFNPPYSDPENG
VWWIDDLPHCAVVVEKLRTPPEPGAITGEMSRGEKTVNALMDTFPEGTVLCMTIVVQPQD
TLEERFTRLSKNAVGENTESIRARQDVKVVKELLGNRHKLYRAGITFLLRAGDMDSLKRK
RVELTTVLLGAGLQPVRPEFDVGPLNSWLRALPMCFDPDMDRKQWYTRLMWVQHLAGLLP
VTGRENGTGHPGFSFFNRGGDVLTFDPLNKLDRTQNAHLLLFGPTGAGKSATLCASLSQV
MAVHRPRLFIAEAGNSFGLLADYFESLGLSVNKISVKPGSGVTLPPFADAHKLVEEGQTL
QSVDEHSLPDLDGDEEEDKRDILGEMEISARMMITGGDPKEEASLKRADRAMIREALLMA
THATYREGRQMLPEDLQVALREISCDAGRNEVRRAKAAEMAESLGMFTQKGSFEAELFNR
EGELWPEADVTLIDLGHLAREGYEAQMALTMVSMTNMINNIAERDQYLGRDIVFAVDEAH
IVTVNPLLSPYMTKVVKMWRKLGAWLWLATQNLKDYPDISEKMLNMAEWWVCLTMPPEEV
NNIARFKSLTEEQKAVLMSASKLSGCYTEGGVLAKKIEALFRAVPPSLYLALGMTEKEEK
AERRMLMKEHNCSELEAAFHVARKLDRLRGLSAVESAA
NT seq 2817 nt   +upstreamnt  +downstreamnt
atggcattcacactgtttaaacgtcgcaatgtcaccacgccatctgaaacggaggcggca
ggacagggttttgttccgcctgtcccgcccggggcacagcccctgaaacgtccggggcag
atgacgcaggaagaggaggcccgggtttatcatgccgggccgtcagttattgattttctt
ccctgggtggagtacctggatgaggctcagtgtctgctgctggatgacggaatgtcggta
ggggctgtttatgacgtgacgccggcggcgacagaagggcgtacggatgaacgtcttgaa
cagatcagggacatggtggaggacgcactgcaggacagctttgatgagtatgacacgcat
ccctgggtggtgcagttcttctgccaggatgaaaatgacgtggatgcgtatcttgattat
ctgaaaggctatgtgaaacctcacgcgcagggaacggcgtttactgaagcctggctgggc
gaaatggaacgccatttgcggggaattgcccgcccggaaggcctttttacagacacgctg
gttaccggtcagccgtggcggggacagcagcggagaacccgtatggtgatttatcgtcgt
atcgcgaagaacaacagtgatccgatgccgccggtggccatgctgaatcaggtttgcgat
cgcgttgtgtcggcactggggagcgccggggtgcgctgtcaccggatgaacggtctgcag
gttcacagctggttactccggttatttaatccggcaccgtcctggattagccgggaggat
ttgtaccggatggcctcaagagccgatccccgtgagaacgatgcggatgttatgccggtg
atgacggactttgcagaaagcctgtggtttaatccgccctattccgatccggagaacggg
gtgtggtggattgatgatctgccacattgtgccgtggtggtggagaagctccgtacgcca
ccggagcccggagccattaccggtgagatgtcccggggagaaaaaacggtgaatgcgctg
atggatacgtttccggaaggaacggtgctgtgcatgaccattgtggtacagccacaggat
accctggaggagcggtttacccggctgtcgaaaaatgccgtgggtgagaatacggagtcc
atccgggcacgtcaggatgtgaaggtggtgaaggagttgctgggtaaccgacataaactc
tatcgtgcggggatcaccttccttctgcgggccggtgatatggacagcctgaaacgtaaa
cgggtggagctgaccacggttctgctgggggcaggcctgcagccggtgcgaccggagttt
gatgtggggccgctgaacagctggctgcgtgcgctgccaatgtgctttgatccggatatg
gacagaaagcagtggtacacacgtctgatgtgggtacagcatctcgctgggcttctgccg
gtgaccggccgggaaaacggtacagggcatcccggcttcagtttttttaaccgaggggga
gatgtcctgacgtttgatcccctgaacaaactggatcgtacccagaatgcccatctgttg
ctgttcgggcccacgggggcagggaagtctgccacgctgtgtgcctctctgtcacaggtg
atggccgtgcatcgtccccggttgtttattgccgaggcgggtaactcgtttggtctgctg
gccgattactttgaaagtctcgggctttcggtgaacaaaatcagtgtcaaaccggggagc
ggtgtgacactgccaccctttgcggatgcgcataagctggttgaagaagggcagaccctg
cagagtgtggatgagcactcgctgcccgatctggatggcgatgaagaggaggataaacgc
gacattctgggagaaatggaaatctctgccaggatgatgatcaccggcggtgatccgaag
gaagaggcctcactcaaacgtgcggaccgggcgatgattcgtgaagcgctgctgatggcc
acacacgcgacgtaccgggaagggcgacagatgctgccggaagatttgcaggtggcactc
cgggaaatctcctgtgatgcgggacgtaacgaggtacgccgggcaaaggcggcagagatg
gcggagtcactgggaatgttcacccagaaagggagttttgaagcggagctgttcaaccgt
gaaggcgaactgtggccggaagcggatgtgacgctgatagacctggggcacctggcccgt
gaggggtatgaggcgcagatggctctgacgatggtgtcaatgaccaatatgattaacaac
atcgctgaacgtgaccagtatctggggcgtgatattgtgtttgcagtggatgaggcgcat
atcgtgacggtgaatccgctgctctcgccctatatgacgaaggtggtgaaaatgtggcgc
aagctgggagcctggctgtggcttgcgacgcagaacctgaaggactatccggatatatca
gagaaaatgctgaacatggcggagtggtgggtgtgtctgacgatgccgccggaagaggtg
aacaacattgcccgttttaaatccctgacggaggagcagaaggcggtgctgatgtcggcg
agcaaactgtccggctgttatacggaggggggtgtcctggcgaagaagattgaggcgctg
ttccgtgcggtgccaccgagtctttatctggctctggggatgacggagaaagaagagaag
gctgagcggcgcatgctgatgaaggaacataactgcagcgaactggaggctgcgttccat
gtggcccgtaaactggacagactgcggggactttccgccgtggagagtgcggcatga

DBGET integrated database retrieval system