KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3564Help
Entry
ECED1_3564        CDS       T00827                                 

Definition
(GenBank) conserved hypothetical protein, putative exported protein
Organism
ecq  Escherichia coli O81 ED1a (commensal)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI Mod_r Nup54 Taxilin UPF0242 Sec34 Hemocyanin_C Coiled-coil_56 DUF2951 Spc7 V_ATPase_I Prominin DUF1664 YabA
Motif
Other DBs
NCBI-ProteinID: CAV17919
UniProt: B7N358
Position
complement(3491117..3492595)
Genome map
AA seq 492 aa AA seqDB search
MQIKSNALVKFVVPAVVLVGLAVTMKSCKTQENVADRGEQARTLSGLSSEELRALGVEGD
TPEDTLRTLVARMNQVRDNQRTLEKQNSQLLKDNEQLRRRSTDVSGQVNDAVAGVQKTYE
QKQRKLQEQQHSLMSQIDAMKDQLSRAETLSRRQESDIPPGLGLDAGGGSGVVITQGADG
LMWVSPADQSQDDPLSSSGSKGGPRFPTSFLEDNALSRQKAEYEQQVKGYSNEQQRATTQ
AVYTLPENSTLTGSRAMTALLGRVPINGTVTDPYPFKILVGRDNLTANGIELPDVEGAIV
SGTASGDWTLSCVRGQVNSITFVFADGTVRTLPSPDVNGTTNSNQQAKGNGTGGIGWISD
EDGIPCISGTRKSNASSYLPTIFALSAAGAAGDALSEGQYTSQNNVNGITSTLTGSAGQA
ALGKALSGGMNETADWVRQRYGQTFDAIYVPPGKALAVHITRQLAIDYEEQGRRVRYDFA
LPGEANDHGGLD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcagattaagtccaacgcgctggtgaaatttgtggtgcccgctgttgttctggtgggg
cttgcagtcacgatgaaaagctgcaaaacgcaggaaaatgttgctgaccgcggggagcag
gcccggaccttatccggattatcgtcagaagagctacgggctcttggggtggaaggtgac
acgccggaagacacattacggacgctggtcgcccgtatgaaccaggtgcgggacaatcag
agaacgctggagaaacagaactcgcaacttcttaaggataacgagcagctgcgcaggcgg
agcacggatgtgtccggtcaggtgaatgacgctgtggcaggggtgcagaaaacctacgaa
cagaagcagcggaaactgcaggagcagcagcattccctgatgtcgcagattgacgccatg
aaagatcaactgagccgggcagagacgctcagtcgccgccaggaaagcgatatcccgccg
gggctcgggcttgatgcgggcggcggcagtggcgtggtgattacgcagggggctgacggg
ctgatgtgggtaagtccggccgatcagtctcaggatgatcccctgagcagcagtggttca
aagggaggccctcgttttccgacctcattccttgaggacaacgcactgagtcgtcagaag
gctgagtatgagcagcaggtgaagggatacagcaatgaacagcagcgagccaccacacag
gcggtctacacgctgccggaaaattcaacgctgacaggcagtcgtgcgatgacggccctg
ctggggcgggtgccgatcaacggcaccgtgacggacccttacccgttcaagatcctggtc
gggcgtgacaacctcacggcaaacggcattgagctgccggatgtggaaggggcgattgtc
tccggcacggccagtggtgactggacgctttcctgtgtgcgcgggcaggtgaacagtatc
acctttgtttttgctgatggcacggtgcgcacgctgccgtcaccggatgtcaacggcacc
accaacagcaatcagcaggcgaaggggaatggtactggcgggattggctggatctccgat
gaagacggtattccctgcatcagcggtacccgtaaatccaatgcgtcaagttatctgcca
acgatatttgcactgtcagccgccggtgcagccggggatgccctgagtgaggggcagtat
acctcgcagaacaatgtcaacggtatcacctccacgctgaccggcagcgcggggcaggct
gcacttggtaaggcgctgtccggtggaatgaatgagacggcagactgggtgaggcagcgt
tacgggcagacgtttgatgccatttatgttcctccggggaaagcgctggcggtacatatt
acccgacaactggctattgattatgaagagcaaggccgccgtgtgcgttatgacttcgcc
ctgccgggtgaagcaaacgaccacggggggcttgactga

DBGET integrated database retrieval system