KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3565Help
Entry
ECED1_3565        CDS       T00827                                 

Definition
(GenBank) conserved hypothetical protein; putative exported protein
Organism
ecq  Escherichia coli O81 ED1a (commensal)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3438
Motif
Other DBs
NCBI-ProteinID: CAR09716
UniProt: B7N048
Position
complement(3492585..3493493)
Genome map
AA seq 302 aa AA seqDB search
MKAGIVCSLLRPAVMMMSLSVLSLTAQADELMKWERIPLNILLKVGQERVIFADKNVRVG
FPPALNGKLRVQSTGGAVYLKADSAFPQTRVQLQDVESGEMILLDVTAGEKGTTEPVRIV
YDGDVSTVSRAAGSDVQTVKSRSSNGKAGMDNGTQARRTEPRYAELLPVLLTRYAAQSLY
APLRTLEPVAGIRPVVPHLPRQITTVYPSEPLTVSPVAAWAAGGRTVVALKLTSTVSRRI
VLDPRALQGRFVAATFQHRWLGAAGTPEDTTMLYVVTAGSPEKAFVEEPVTSRRGGEVTH
AD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccggcattgtgtgcagtctgctgcgtcctgccgtcatgatgatgtcgttgtca
gtgctgagtctgacggcacaggcggatgaactgatgaagtgggagcgtataccgctgaat
atcctgctgaaggtggggcaggagcgggtgatttttgcggataaaaatgtgcgggtgggc
ttccctccggcgctgaatggaaaactgcgggtccagagtaccggtggtgcggtctacctg
aaggcagacagtgcatttccgcagacccgggttcagctgcaggatgtggaaagcggggaa
atgatcctgctggatgtcactgcgggggaaaagggaaccacggagcccgtgcgtatcgtg
tatgacggagacgtgagtacggtcagccgtgctgccgggagtgatgtacagactgtgaaa
agtcgcagcagcaacgggaaggcggggatggataatggtactcaggcccgtcgcacggag
ccccgttatgctgagctcctgccggtgctgttgacccggtatgcggcacagtccctgtat
gcaccactgcgcacccttgaaccggtggcggggatcagaccggtggtgccacatcttccc
cggcagatcaccacggtttatccgtcagagccgctgactgtttcaccggtggcggcatgg
gcagccggtggccggacggtggtggccctgaaactcaccagtacggtaagcaggcgtatt
gtgcttgatccccgggcccttcaggggcgttttgtggcggcgactttccagcatcgctgg
ctgggtgctgccggtacgccggaagataccacgatgctgtatgtggtgacggcgggcagt
ccggagaaggcgtttgtggaagagcctgtaacgtcccgcaggggcggggaggtgacgcat
gcagattaa

DBGET integrated database retrieval system