KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3574
Entry
ECED1_3574        CDS       T00827                                 

Definition
(GenBank) putative plasmid transfer protein
Organism
ecq  Escherichia coli O81 ED1a (commensal)
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 AAA_22
Other DBs
NCBI-ProteinID: CAR09580
UniProt: B7MZR2
Position
complement(3497385..3499502)
AA seq 705 aa
MSNRYVIEALLRPAVEFNTAVVAATAAGICVTAPWAVALAPSVSYVTAAGFGVLAAVRFR
QGMKIIRYRRNLRRLPRYVMSTRQIPVSRQRLFLGRGFRWTQKHTQRLQDTLRPEVAHYL
QPGSLYRTARWLEMKTEHSLPWIGQLIRRDSPLNPVRPLPPVGGNPALHGIEPDEQDVTL
ALGERVGHTIVYGTTRVGKTRLAELLVTQDIRRGEVTIVFDPKGDADLLLRVWAEAHRAG
RGDELYIFHLGWPEISARYNAVGRFGRVSEVASRVAGQLSGEGNSAAFREFSWRFVNIIA
RALVALGERPDYMLIMRYVNNIADLYIRYAGKVIRERLPGLEQIIANNQSVLSEEDVPRT
MQNQPDAVRIWSIEMALSSEDGKKIYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GRIAELLAPDYMDMRDARPIFDWEQVIRKKAVVYIGLDALSDSEVASAVGNSMFADLVSV
AGHIYKHGMHAGLPAGGAGKNVVNLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQTSS
DIEARIGNAAKTAQVQGNFNNMIMLRVRENRTAELLTTQLPQVEIYTKTLVSGHQDTADV
SAGQDFTSSTQDRVGTVKVPLLEPADIVTLPKGQAFALLEGGQLWKIRMPLPAGDTDDVL
MPESISRVAEAMRQNYHSGEGWWNAPPLVQAIATEEGGDHGGSTS
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgagtaaccgttatgttattgaggcgttactgaggccagctgtggagttcaatacggcc
gtggttgcggcaacggcggccggtatctgtgtgacagccccctgggcggtagcgcttgcg
ccttcggtcagttatgtcacagctgccggatttggcgttctggcggctgtccgtttccgc
cagggcatgaaaatcatccgctaccgacgcaatctgcgtcggttaccccgctatgtgatg
agcacgcggcaaattcctgtcagccgtcagcgactgtttctggggcggggatttcgctgg
acacagaagcacacccagcgccttcaggacacgctgcgaccggaggttgcgcactatctt
cagccgggcagtctgtaccggacagcgcgctggcttgaaatgaaaacggagcacagtctt
ccctggattgggcagcttattcgtcgtgactcgccgctgaatcccgtccgtcccctgccg
ccggtgggaggaaatcctgccctgcatggtattgagccggatgagcaggatgtgacgctg
gcactgggtgaacgtgtggggcacaccattgtctatggcaccacccgtgtcgggaaaacc
cgtctggcagagttgctggtcacccaggatatccggcggggagaagtgaccatcgttttt
gatcccaagggggatgcagatctgctgctgcgggtctgggctgaagcgcaccgggccggg
cggggggatgagttgtatatctttcaccttggctggcctgaaatttcagcccgttacaat
gcggtgggacgctttggtcgtgtatcggaagtggcttcccgtgttgctggtcagttgtcc
ggtgaaggtaattcggcggctttccgggagttttcctggcgctttgtcaatatcatcgcc
cgcgccctggtggccctcggtgagcgtccggactatatgctgattatgcggtatgtgaac
aacatcgctgacctctacattcgctatgcggggaaggtgatccgtgagcgtctgcccgga
ctggagcagattatcgcgaataaccagagtgttctcagcgaggaagatgtgcccaggacc
atgcagaaccagccggatgcggtgcggatctggtcgattgaaatggcactgagcagtgag
gacggtaaaaaaatatacgatccgattctggatggacttcgtagtgctgtccgttatgac
cgtacgtattttgacaaaatcgtggcttccctgctgccgttactggaaaaactcaccacc
ggcaggattgcagagctgctggcgccggactatatggatatgagagatgcgcgccccatt
tttgactgggaacaggtgattcgcaaaaaggcggtggtttatatcggcctcgatgcgctc
agtgacagtgaggtggccagtgccgtgggaaattcgatgtttgcggacctggtgagtgtg
gcagggcatatatataaacacggtatgcatgccggtctgccggctggcggggcgggtaaa
aatgtggtgaacctgcactgtgatgagtttaacgaactgatgggcgatgaattcattccg
ctcatcaacaaggggggcggcgccggaatgcaggtgaccgcgtacacccagacgtcatcg
gatattgaagcgcgtattggtaatgcggccaaaacggcgcaggttcaggggaactttaac
aacatgatcatgctgcgcgtcagggagaaccggacggcggaattgctgaccacacaactg
ccccaggtggagatttacacgaagacgctggtctccggtcatcaggatacggcagatgtg
tcagccggtcaggatttcacctccagtacccaggatcgcgtcgggacggtgaaagtcccc
ctgctggagcccgcagatattgtcacgctgcccaagggacaggcatttgccctgctggaa
ggtggacagttatggaagatccggatgccgctgccggcaggtgatacggatgatgtgctg
atgccggagagtatttcccgggtggcggaggcgatgcgacagaattatcactccggtgaa
ggatggtggaatgctccacctttagtacaggcgatagcgacggaggagggaggtgaccat
ggcggaagcacgtcgtga

DBGET integrated database retrieval system