KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3579Help
Entry
ECED1_3579        CDS       T00827                                 

Definition
(GenBank) conserved hypothetical protein, putative exported protein
Organism
ecq  Escherichia coli O81 ED1a (commensal)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAR09730
UniProt: B7N062
Position
complement(3502064..3502786)
Genome map
AA seq 240 aa AA seqDB search
MKMKNLSPVLMLLISLQTVAAVRESAPEGTRTQASSQVSTTTQALQQQAAQWGVTEEDYR
RYRALMEGPRGIQSPGLDPLTVLGIEARTDAERRQLAEKWVKAEYERTEKELAFQREVNA
AWKRLYPGVMPVSLGKGGGLLNDNGGRLALFVKAKDCGTCDARLASVLSSGRQVDIYLVD
SQGSDNLLRQWALEHDIPVDRVRSRHITLNHDAGRWLRFGEGRMPVVLQQGADGWRVAAF
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaagaatctgtcaccggtgctcatgctgctcatttccctgcagacggtggct
gccgtacgggagagtgcgcctgagggcacacgcacgcaggcctcttcgcaggtcagtacc
accacacaggcgctgcagcaacaggccgctcagtggggagtcactgaggaggattaccgt
cgataccgggctctgatggagggaccgcgggggattcagtcccccggtctggatccgctg
acggtgctggggattgaagcacggacggatgcggaacgccggcagctggctgaaaaatgg
gtgaaggccgaatatgagcggactgagaaggaactggcatttcagcgggaagtcaatgcg
gcctggaaacgcctttatccgggcgttatgccggtcagcctggggaaagggggcgggctg
ctaaacgacaacggcgggcggctggcgttgtttgtgaaagcgaaagactgtggaacctgt
gatgcacgactggcatcagtgttgtcttcggggcggcaggtggatatttacctggttgac
agtcagggcagtgacaatctgctgcggcagtgggcactggagcacgatatccctgtggac
cgggtgcgaagccgccatattaccctgaatcatgatgccggtcgctggctgcgttttggt
gaaggcagaatgccggttgtactgcagcagggagcggacggatggcgcgtggcagccttc
tga

DBGET integrated database retrieval system