KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3835Help
Entry
ECED1_3835        CDS       T00827                                 

Gene name
folP
Definition
(GenBank) 7,8-dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00790  Folate biosynthesis
ecq01100  Metabolic pathways
Module
ecq_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECED1_3835 (folP)
Enzymes [BR:ecq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ECED1_3835 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CAR09838
UniProt: B7N0H0
Structure
PDB: 

Position
complement(3766747..3767595)
Genome map
AA seq 282 aa AA seqDB search
MKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGE
STRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSL
SEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKE
KLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVGPSERLSGSL
ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctttgcccagggcacttcactggaccttagccatcctcacgtaatggggatc
ctcaacgtcacgcctgattccttttcggatggcggtacgcataactcgctgatagatgcg
gtgaaacatgcgaatctgatgatcaacgctggcgcgacgatcattgacgttggtggcgag
tccacgcgcccaggagcggcggaagttagcgttgaagaagagttgcaacgtgttattcct
gtggttgaggcaattgctcaacgcttcgaagtctggatctcggtcgatacatccaaacca
gaagtcatccgtgagtcagcgaaagttggcgctcacattattaacgatatccgctccctt
tccgaaccaggggctctggaggcagctgcagaaaccggtttaccggtttgtctgatgcat
atgcagggaaatccaaagaccatgcaggaagccccgaagtatgacgatgtctttgcagaa
gttaatcgctattttattgagcaaatagcacgttgcgagcaggcgggtatcgcaaaagag
aaattgttgctcgaccccggattcggtttcggtaaaaatctctcccataactattcatta
ctggcgcgcctggctgaatttcaccatttcaacctgccgctgttggtgggtatgtcacga
aaatcgatgattgggcagctgctgaacgtggggccgtccgagcgtctgagcggtagtctg
gcttgtgcggtcattgccgctatgcaaggcgcgcatatcattcgtgttcatgacgtcaaa
gaaaccgtagaagcgatgcgggtggtggaagccactctgtctgcaaaggaaaacaaacgc
tatgagtaa

DBGET integrated database retrieval system