KEGG   Escherichia coli O81 ED1a (commensal): ECED1_4027Help
Entry
ECED1_4027        CDS       T00827                                 

Gene name
ppiA
Definition
(GenBank) peptidyl-prolyl cis-trans isomerase A (rotamase A)
  KO
K03767  peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ECED1_4027 (ppiA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ecq03110]
    ECED1_4027 (ppiA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecq04147]
    ECED1_4027 (ppiA)
Enzymes [BR:ecq01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     ECED1_4027 (ppiA)
Chaperones and folding catalysts [BR:ecq03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    ECED1_4027 (ppiA)
Exosome [BR:ecq04147]
 Exosomal proteins
  Proteins found in most exosomes
   ECED1_4027 (ppiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-ProteinID: CAR10019
UniProt: B7N101
Structure
PDB: 

Position
complement(3929145..3929717)
Genome map
AA seq 190 aa AA seqDB search
MFKSTLAAMAAVFALSALSPAAMAAKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYV
NSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADK
DSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKP
VVILSAKVLP
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaatcgaccctggcggcgatggctgctgttttcgctctttctgctctttctccc
gcagcaatggcagcgaaaggggacccgcacgtattgttgacaacctcagctggtaacatc
gaactggagctggataaacaaaaagcgccagtgtctgtgcaaaactttgtcgattatgtg
aacagtggtttttataacaacacgacctttcaccgcgtcattcctggctttatgattcag
ggcggtggtttcaccgagcagatgcagcagaaaaaaccaaacccgccaatcaaaaatgaa
gcagataacggcctgcgcaacacgcgtggcaccatcgcgatggcgcgtaccgctgacaaa
gacagcgccaccagccagttctttatcaacgttgccgataacgccttccttgaccacggt
cagcgtgatttcggttacgcggtatttggtaaagtggtgaaaggcatggacgttgccgat
aagatttcccaggtgccgactcatgacgttggtccgtaccagaatgtgccgtcaaaaccg
gtagttatcctttccgctaaagtcctgccgtaa

DBGET integrated database retrieval system