KEGG   Escherichia coli O81 ED1a (commensal): ECED1_4621Help
Entry
ECED1_4621        CDS       T00827                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00010  Glycolysis / Gluconeogenesis
ecq00051  Fructose and mannose metabolism
ecq00562  Inositol phosphate metabolism
ecq01100  Metabolic pathways
ecq01110  Biosynthesis of secondary metabolites
ecq01120  Microbial metabolism in diverse environments
ecq01130  Biosynthesis of antibiotics
ecq01200  Carbon metabolism
ecq01230  Biosynthesis of amino acids
Module
ecq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecq_M00002  Glycolysis, core module involving three-carbon compounds
ecq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECED1_4621 (tpiA)
   00051 Fructose and mannose metabolism
    ECED1_4621 (tpiA)
   00562 Inositol phosphate metabolism
    ECED1_4621 (tpiA)
Enzymes [BR:ecq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ECED1_4621 (tpiA)
Exosome [BR:ecq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ECED1_4621 (tpiA)
  Exosomal proteins of bladder cancer cells
   ECED1_4621 (tpiA)
  Exosomal proteins of melanoma cells
   ECED1_4621 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAR10729
UniProt: B7N2R0
Structure
PDB: 

Position
complement(4562119..4562886)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtatctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgtgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggccactctgaacgtcgtact
taccacaaagaatctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcaggga
ctgactccggttctgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaactgaa
gaagtttgtgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacattgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagacatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgccgtgatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system