KEGG   Escherichia coli O81 ED1a (commensal): ECED1_4734Help
Entry
ECED1_4734        CDS       T00827                                 

Definition
(GenBank) sorbose-specific phosphotransferase enzyme IIA component (PTS system)
  KO
K02812  sorbose PTS system EIIA component [EC:2.7.1.206]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00051  Fructose and mannose metabolism
ecq01100  Metabolic pathways
ecq02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECED1_4734
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECED1_4734
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecq02000]
    ECED1_4734
Enzymes [BR:ecq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     ECED1_4734
Transporters [BR:ecq02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    ECED1_4734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man STb_secrete HTH_DeoR
Motif
Other DBs
NCBI-ProteinID: CAR10839
UniProt: B7MRF1
Position
complement(4691669..4692076)
Genome map
AA seq 135 aa AA seqDB search
MVNAIFCAHGKLACAMLESVQMVYGDARVEAVEFVPGENAGDIVAKLEKLVSIHNHDEWL
IAVDLQCGSPWNAAAMLAMRNPRLRVISGLSLPLALELVDNQDSMNVDELCEHLTQIAKQ
TCVVWRQVATAEEDF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatgccattttttgcgcccacggcaaattagcctgcgccatgctggaatcggtt
cagatggtgtacggcgatgccagggtcgaggcagttgaatttgtgcccggcgagaacgcc
ggagacattgtggcaaagctggagaagttagtgagcattcacaatcatgacgagtggcta
atcgccgtggatttacagtgcggcagcccgtggaatgcggcagcgatgcttgcgatgcgc
aatcctcgtctgcgggtaatcagcggcctttctctgccgctggcgctcgaactggttgat
aaccaggacagcatgaatgttgatgaactgtgtgaacacctgacgcaaatcgcaaagcaa
acctgcgtcgtctggagacaggtggcaacagcggaggaggatttctga

DBGET integrated database retrieval system