KEGG   Escherichia coli O81 ED1a (commensal): ECED1_4797Help
Entry
ECED1_4797        CDS       T00827                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00010  Glycolysis / Gluconeogenesis
ecq00620  Pyruvate metabolism
ecq00640  Propanoate metabolism
ecq00680  Methane metabolism
ecq01100  Metabolic pathways
ecq01110  Biosynthesis of secondary metabolites
ecq01120  Microbial metabolism in diverse environments
ecq01130  Biosynthesis of antibiotics
ecq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECED1_4797 (acs)
   00620 Pyruvate metabolism
    ECED1_4797 (acs)
   00640 Propanoate metabolism
    ECED1_4797 (acs)
  Energy metabolism
   00680 Methane metabolism
    ECED1_4797 (acs)
Enzymes [BR:ecq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ECED1_4797 (acs)
Lipid biosynthesis proteins [BR:ecq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ECED1_4797 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAR10756
UniProt: B7N2T6
Position
complement(4757273..4759231)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINAPDTFWGEQGKILDWITPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDL
VEQASAQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgcaccagataccttctggggc
gaacagggaaaaattctcgactggatcacaccgtaccagaaggtgaaaaacacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgtaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatattagctataaagaactgcaccgcgacgtctgccgcttc
gccaataccctgctcgaactgggcattaaaaaaggtgacgtagttgcgatttatatgccg
atggtaccggaagccgcggtcgcgatgctggcctgcgcccgcattggcgcggtacattcg
gtgattttcggcggcttctcgccggaagccgttgccggacgcattatcgactccagttca
cgactggtgatcacttccgacgaaggtgtgcgtgccgggcgtagtattccgctgaagaaa
aacgttgatgacgcgctgaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggtggaaaaattgactggcaggaagggcgcgacctgtggtggcacgacctg
gttgagcaagccagcgctcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctatacctccggttctaccggtaagccaaaaggcgtgctgcacactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggcgatatc
tactggtgcaccgccgatgtgggctgggttaccggacacagttatttgctgtatggcccg
ctggcctgcggcgcgaccacgctgatgtttgaaggcgtaccgaactggccgacgcctgcc
cgtatggcgcaggtggtggacaagcatcaggtcaatattctctataccgcgcccacggcg
attcgcgcgctgatggcggaaggcgataaagcgatcgaaggcaccgaccgttcgtcgctg
cgcattctcggttccgtgggcgagccaattaacccggaagcgtgggagtggtactggaag
aagatcggcaacgagaaatgcccggtggtcgacacctggtggcagaccgaaactggcggt
ttcatgatcacgccactgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccggcgctggtcgataacgaaggtaacccgctggagggggccacc
gaaggcagtctggtgatcaccgactcctggccgggtcaggcgcgtacgctgtttggcgat
cacgaacgttttgagcagacctacttctccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaagatggctattactggatcaccgggcgcgtggacgacgtgctg
aacgtctccggtcaccgcctggggacggcagagattgagtcggcgctggtggcgcatccg
aaaattgccgaagccgctgtggtcggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggccatcgcgatgccatcgtaa

DBGET integrated database retrieval system