KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_0164Help
Entry
ECIAI1_0164       CDS       T00828                                 

Gene name
glnD
Definition
(GenBank) uridylyltransferase
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECIAI1_0164 (glnD)
Enzymes [BR:ecr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     ECIAI1_0164 (glnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnD_UR_UTase ACT HD NTP_transf_2 DUF294 Polbeta ACT_4
Motif
Other DBs
NCBI-ProteinID: CAQ97052
UniProt: B7M1A6
Position
complement(185385..188057)
Genome map
AA seq 890 aa AA seqDB search
MNTLPEQYANTALPTLPGQPQNPCVWPRDELTVGGIKAHIDTFQRWLGDAFDNGISAEQL
IEARTEFIDQLLQRLWIEAGFSQIADLALVAVGGYGRGELHPLSDIDLLILSRKKLPDDQ
AQKVGELLTLLWDVKLEVGHSVRTLEECMLEGLSDLTVATNLIESRLLIGDVALFLELQK
HIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSSPGGLRDIHTLQWVARRHF
GATSLDEMVGFGFLTSAERAELNECLHILWRIRFALHLVVSRYDNRLLFDRQLSVAQRLN
YSGEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEAILALPADEKPRPIDDEFQLRGTL
IDLRDETLFMRQPEAILRMFYTMVRNSAITGIYSTTLRQLRHARRHLQQPLCNIPEARKL
FLSILRHPGAVRRGLLPMHRHSVLGAYMPQWSHIVGQMQFDLFHAYTVDEHTIRVMLKLE
SFASEETRQRHPLCVDVWPRLPSTELIFIAALFHDIAKGRGGDHSILGAQDVVHFAELHG
LNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQFAEEVQTENRLRYLVCLTVADICA
TNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDMRERVRHHQLQALALLRMDNIDEEAL
HQIWSRCRANYFVRHSPNQLAWHARHLLQHDLSKPLVLLSPQATRGGTEIFIWSPDRPYL
FAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFIVLEPDGSPLSADRHEVIRFGLEQVLTQ
SSWQPPQPRRQPAKLRHFTVETEVTFLPTHTDRKSFLELIALDQPGLLARVGKIFADLGI
SLHGARITTIGERVEDLFIIATADRRALNNELQQEVHQRLTEALNPNDKG
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccttccagaacagtacgcaaacaccgctctccccaccctgcccggtcaaccg
caaaatccatgcgtctggccccgtgatgaattaaccgtcggtgggataaaagcccatatc
gatactttccagcgttggctgggtgatgcctttgacaatgggatctctgcagaacagttg
attgaggcgcgcaccgagtttatcgaccagctcctgcaacgattatggattgaagcggga
ttcagccagattgccgacctggcattggtcgccgtcggtggctacggtcgtggcgagctg
catccactttctgacatcgatttactgattttaagccgtaaaaagctcccggacgatcag
gcgcaaaaagtgggcgagctgttaacgctgctctgggatgtaaagctggaagtcggtcat
agtgtgcgcacgcttgaagagtgcatgctggaagggttatcggatttaaccgtcgccacc
aatttaatcgaatcccgcttattaattggcgatgttgcgctcttcctcgaactgcaaaaa
catatttttagcgaaggattctggccttccgacaagttctacgcggcgaaagttgaagaa
cagaaccagcgccatcagcgttaccatggcaccagctacaaccttgaaccagacatcaaa
agtagccctggcggcttgcgcgatattcacactctgcaatgggtggcccgccgtcatttt
ggcgcaacatcgctggatgaaatggtcgggtttggcttcttaacctcagcggagcgggcg
gaattaaacgaatgtctgcatatactgtggcgtattcgctttgccctgcatctggtcgtc
agccgttacgataatcgtctgttattcgatcgccaacttagcgtcgctcagcgtctgaat
tacagtggtgaaggcaacgaaccggtcgagcggatgatgaaggattacttccgcgttaca
cgccgcgtcagtgaactcaaccagatgctgctgcaactgttcgatgaagccatcctcgcc
cttcccgccgacgaaaaaccacgtccaatcgacgatgagtttcagctacgcggtacgcta
atcgacctgcgtgatgaaacactatttatgcgccagccggaagccatcttgcgtatgttc
tacaccatggtgcgcaacagtgcgatcaccggcatttactccaccacgctgcgccagtta
cgccatgcccgtcgccatctgcaacaaccgctgtgtaatattccggaagcacgaaaactg
tttttgagcattctgcgtcaccccggagcggtgcggcgcgggctattgccaatgcatcgc
catagcgtgctcggcgcgtatatgccgcaatggtcgcatatcgtcgggcagatgcagttt
gatctgttccacgcctacacggtggatgaacatactatccgcgtgatgctgaaactggag
agttttgccagtgaagaaacgcgccagcgccatccgttgtgtgtggacgtctggccgcgc
ctgccgtcaactgagctgattttcatcgccgcgctgtttcacgatatcgccaaaggacgc
ggcggcgaccactccattctcggtgctcaggatgtagtgcattttgcagaactccacggg
ctgaactcacgcgaaacacagctggttgcctggctggttcgccagcacttgctgatgtcg
gtgacagcacaacgccgcgatattcaggaccctgaagtcatcaagcagtttgccgaagaa
gttcaaacggaaaatcgtctgcgctatctggtatgcctgacagtggctgacatttgcgcc
accaacgaaacgctgtggaatagctggaagcaaagtctgttgcgcgaactctattttgcc
accgaaaagcagctacgacgcggaatgcaaaacacgccggatatgcgcgaacgggttcgc
catcaccaactccaggcactggcactactgcgcatggataacatcgacgaagaggcgctg
caccaaatttggtcacgctgtcgtgctaactattttgtccgccatagcccaaatcaactg
gcctggcatgcccgccatttattacagcatgatttaagcaaaccgctggtattgcttagc
ccgcaggctacgcgtggaggcaccgagatttttatctggagcccggaccgcccctatctg
tttgccgccgtctgtgccgaattagaccgccgcaatttaagtgttcacgacgcacaaatt
ttcaccactcgcgacggtatggcgatggatacctttatcgtgctggaacccgatggcagc
ccgctgtccgcagatcgtcatgaggttattcggtttggtctggagcaagtactgacgcaa
agtagctggcagccaccgcagccccgtcgccaacccgccaaattacgccattttactgtt
gaaaccgaagtaacgtttttgccgacccataccgaccgcaaatcgttccttgagcttatc
gcgctcgaccagccaggactgctggcgagagtcgggaaaatttttgccgatctgggaatt
tcgcttcatggtgcccgaattacaaccattggcgagcgagtagaagatttattcataatt
gccaccgctgaccggcgtgcacttaataacgagttgcagcaggaagtgcatcagcggttg
acagaggccctcaatccaaacgataaagggtga

DBGET integrated database retrieval system