KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_0238
Entry
ECIAI1_0238       CDS       T00828                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecr02044]
    ECIAI1_0238
Secretion system [BR:ecr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECIAI1_0238
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CAQ97112
Position
complement(254658..256508)
AA seq 616 aa
MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERLLEGVAFLTGNLRQKI
EDEFPELTHGLIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLIPRNEQFTTNAGEIRVD
EVLPSDAKKEEPPPCTFTLCRDIWLLPVRLEQIENRSTTRNGVINITFSVAPGTDFRTLD
LNKLRFWLGNDDNYTRNQLYLWFCEYLQGADLTVGEQHIRLPEFMLKAVGFEPQDAMLPW
PKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQGESFTLQLRFSRPLPVDIRLRRD
SLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPEHYDVFSVNGVISQVQDMFRKK
DLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRTKTSLFHRGFDHTLAFIHADGS
YPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTGKNAAVASFRNITRPTQPLWPVI
DGSLHWSLLSAMNLNYLSLLDTDALKQVIANFDRHAIHHPQTARLSQQKLDAIERLETRP
VDRLFTGIPVRGLASTLYLHPEPFVCEGEMYLLGTVLSHFLSLYASVNSFHMLTVVNTES
QETWKWTERTGQHPLI
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggaatttgaagaacgctatttccgggaagaactcgattacctgcgccagctcagcaag
ctgctggcaacggaaaaaccccatcttgcccgcttcctggccgaaaaagatgcggatccg
gatattgaacgcctgctggaaggcgtggcttttcttaccggcaatctccgccagaaaatt
gaggatgaattcccagaactgacgcacgggcttattaagatgctctggcctaattacctg
cgtccggttccggcaatgacccttattgaatatacgccggatatggataagtcttctgtg
ccggtgttaatcccccgtaatgagcagtttacaaccaacgccggggaaatcagagtcgat
gaagtgctgccctccgatgctaaaaaggaggagccgcctccctgtaccttcaccctctgc
cgggatatctggctgctgcccgttcgcctggagcagattgaaaaccgcagtacgacccgt
aatggtgttatcaacatcaccttttcggtcgcaccgggaacggacttccgcacgctggat
ctgaacaaacttcgcttctggctcggcaatgacgacaactatacccgtaaccagctttat
ttatggttctgtgaatacttgcagggtgccgacctgactgtgggtgaacagcatattcgc
ctgcctgagtttatgctgaaagctgtcggttttgagccgcaggatgccatgctgccttgg
ccgaaaaacgtccacagcggctaccggatccttcaggagtatttctgttacccggatgcg
tttctcttttttgatctttgtggttgcccggcgttgcctgacggattgcagggtgaatcc
tttaccctgcaactgcgtttttcgcgcccattgcccgtggacatccggttgcgccgcgac
tccctgcgcctgtattgcgcgcctgccattaatttatttatccaccatgcagaagccatc
acgctggacaaccggcgggcagactatccgctggttcccagccgccattatccggaacat
tacgatgtcttttccgttaacggcgtgataagccaggtgcaggatatgttcaggaaaaaa
gatctggggcgtcctgtttcgacgcaggccgcgcgccagtggcctgcctttgaaagtttc
agccatcagatggaatacagccggaagcgggaagtggtgtactggcatcaccggaccaaa
acatccctgttccatcgcggctttgatcatacccttgcttttatacatgctgatggcagt
tatccgtcagacgaatcgctgctcagtaatgaagtggtttcggtatcgctgacctgtacc
aaccgtgagcttccgtcacaaattcgttccggcgatatcaccggcacaaccggtaaaaat
gcggctgttgcttcatttcgcaacattacccgcccgacgcaaccgctctggccggtcatt
gatggcagcctgcactggtccctgctctccgccatgaacctgaattatctgtcattactg
gatacggacgcgctgaagcaggtcatcgccaactttgatcgccacgcaatccatcatccg
cagacggcgcggctgtcacaacaaaagctggatgccattgagcgtctggagacccgccct
gtcgatcgcctgtttacgggcattcccgtccgggggctggcctccacgctgtatctgcac
ccggagccgtttgtctgtgaaggggaaatgtatctgctcggtacggtgctttcgcatttt
ctgtcgctgtacgccagcgttaactcattccacatgctgaccgttgtgaacacagaaagc
caggagacatggaaatggacggaaagaaccgggcagcatcctcttatctga

DBGET integrated database retrieval system