KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_0440Help
Entry
ECIAI1_0440       CDS       T00828                                 

Gene name
tig
Definition
(GenBank) peptidyl-prolyl cis/trans isomerase (trigger factor)
  KO
K03545  trigger factor
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    ECIAI1_0440 (tig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trigger_N Trigger_C FKBP_C SurA_N_3 DUF4172 DUF3811
Motif
Other DBs
NCBI-ProteinID: CAQ97312
UniProt: B7M3S9
Structure
PDB: 

Position
469879..471177
Genome map
AA seq 432 aa AA seqDB search
MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA
SVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFTYSVEFEVYPEVELQGL
EAIEVEKPIVEVTDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSVDGEEFEGG
KASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKV
EERELPELTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSAIRNRVKSQAIEGLVKANDI
DVPAALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQAKRRVVVGLLLGEVIRTNEL
KADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMRNVALEEQAVEAVLAKAKVTEK
ETTFNELMNQQA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtttcagttgaaaccactcaaggccttggccgccgtgtaacgattactatcgct
gctgacagcatcgagaccgctgttaaaagcgagctggtcaacgttgcgaaaaaagtacgt
attgacggcttccgcaaaggcaaagtgccaatgaatatcgttgctcagcgttatggcgcg
tctgtacgccaggacgttctgggtgacctgatgagccgtaacttcattgacgccatcatt
aaagaaaaaatcaatccggctggcgcaccgacttatgttccgggcgaatacaagctgggt
gaagacttcacctactctgtagagtttgaagtttatccggaagttgaactgcagggtctg
gaagcgatcgaagttgaaaaaccgatcgttgaagtgaccgatgctgacgttgacggcatg
ctggatactctgcgtaaacagcaggcaacctggaaagaaaaagacggcgctgttgaagca
gaagaccgcgtaaccatcgacttcaccggttctgtagacggcgaagagttcgaaggcggt
aaagcgtctgatttcgtactggcgatgggccagggtcgtatgatcccgggctttgaagac
ggtatcaaaggccacaaagctggcgaagagttcaccatcgacgtgaccttcccggaagaa
taccacgcagaaaacctgaaaggtaaagcagcgaaattcgctatcaacctgaagaaagtt
gaagagcgtgaactgccggaactgactgcagaattcatcaaacgtttcggcgttgaagat
ggttccgtagaaggtctgcgcgctgaagtgcgtaaaaacatggagcgcgagctgaagagc
gccatccgtaaccgcgttaagtctcaggcgatcgaaggtctggtaaaagctaacgacatc
gacgtaccggctgcgctgatcgacagcgaaatcgacgttctgcgtcgccaggctgcacag
cgtttcggtggcaacgaaaaacaagctctggaactgccgcgcgaactgttcgaagaacag
gctaaacgtcgcgtagttgttggcctgctgctgggcgaagttatccgcaccaacgagctg
aaagctgacgaagagcgcgtgaaaggcctgatcgaagagatggcttctgcgtacgaagat
ccgaaagaagttatcgagttctacagcaaaaacaaagaactgatggacaacatgcgcaat
gttgctctggaagaacaggctgttgaagctgtactggcgaaagcgaaagtgactgaaaaa
gaaaccactttcaacgagctgatgaaccagcaggcgtaa

DBGET integrated database retrieval system