KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_0658Help
Entry
ECIAI1_0658       CDS       T00828                                 

Gene name
glnS
Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00970  Aminoacyl-tRNA biosynthesis
ecr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECIAI1_0658 (glnS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecr01007]
    ECIAI1_0658 (glnS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ecr03016]
    ECIAI1_0658 (glnS)
Enzymes [BR:ecr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     ECIAI1_0658 (glnS)
Amino acid related enzymes [BR:ecr01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   ECIAI1_0658 (glnS)
Transfer RNA biogenesis [BR:ecr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ECIAI1_0658 (glnS)
 Prokaryotic type
   Other AARSs
    ECIAI1_0658 (glnS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C
Motif
Other DBs
NCBI-ProteinID: CAQ97526
UniProt: B7M5J8
Structure
PDB: 

Position
709487..711151
Genome map
AA seq 554 aa AA seqDB search
MSEAEARPTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKG
QCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLA
YVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMA
SPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDALEGITHSLCTLEFQDNRRL
YDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRR
GYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYQGE
GEMVTMPNHPNKPEMGSRQVPFSGEIWIDRADFREEANKQYKRLVLGKEVRLRNAYVIKA
ERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIHWVSAAHALPVEIRLYDRLFSVP
NPGAADDFLSVINPESLVIKQGFAEPSLKDAVAGKAFQFEREGYFCLDSRHSTAEKPVFN
RTVGLRDTWAKVGE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggcagaagcccgcccgactaactttatccgtcagatcatcgatgaagatctg
gccagtggtaagcacaccacagtacacacccgtttcccgccggagccgaatggctatctg
catattggccatgcgaaatctatctgcctgaacttcgggatcgcccaggactataaaggc
cagtgcaacctgcgtttcgacgacactaacccggtaaaagaagatatcgagtatgttgag
tcgatcaaaaacgacgtagagtggttaggttttcactggtctggtaacgtccgttactcc
tccgattattttgatcagctccacgcctatgcgatcgaactgatcaataaaggcctggcg
tacgttgatgaactgacgccggaacagatccgcgaataccgcggcaccctgacgcaaccg
ggtaaaaacagcccgtaccgcgaccgcagcgttgaagagaacctggcgctgttcgaaaaa
atgcgtgccggtggttttgaagaaggtaaagcctgcctgcgtgcgaaaatcgacatggct
tcaccgtttatcgtgatgcgcgatccggtgctgtaccgtattaaatttgctgaacaccac
cagactggcaacaagtggtgcatctacccgatgtacgacttcacccactgcatcagcgat
gccctggaaggtattacgcactctctgtgtacgcttgagttccaggacaaccgtcgcctg
tacgactgggtgctggacaacatcaccattcctgttcacccgcgccagtacgaattctcg
cgcctgaatctggaatacactgtgatgtccaagcgtaagctgaacctgctggtgaccgac
aagcacgttgaaggctgggatgacccgcgtatgccgaccatttctggtctgcgtcgtcgt
ggttacactgcggcttctattcgtgagttctgcaaacgcattggcgtgaccaagcaggac
aacaccattgagatggcgtcgctggaatcctgcatccgtgaagatctcaacgaaaatgcg
ccgcgcgcaatggcggttatcgatccggtgaaactggttatcgaaaactatcagggcgaa
ggcgaaatggtcaccatgccgaaccatccgaacaaaccggaaatggggagccgtcaggtg
ccgtttagcggtgagatttggatcgatcgcgccgatttccgcgaagaagctaacaagcag
tacaaacgtctggtgctgggtaaagaagtgcgtctgcgtaatgcttacgtcattaaggct
gaacgcgtggagaaagatgccgaaggcaatatcaccaccatcttctgtacttatgacgcc
gacaccttaagcaaagatccggcagatggtcgtaaagtcaaaggtgttattcactgggtg
agcgcggcacatgcgctgccggttgaaatccgtctgtacgaccgtctgttcagcgtgccg
aaccctggtgctgcggatgatttcctgtcggtgattaacccggaatcgctggtgatcaaa
cagggctttgctgaaccgtcgctgaaagatgcggttgcgggtaaagcattccagtttgag
cgtgaaggttacttctgcctcgacagccgccattccacagcggaaaaaccggtatttaac
cgcaccgttgggctgcgtgatacctgggcgaaagtaggcgagtaa

DBGET integrated database retrieval system