KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_1892Help
Entry
ECIAI1_1892       CDS       T00828                                 

Gene name
rrmA
Definition
(GenBank) 23S rRNA m1G745 methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ecr03009]
    ECIAI1_1892 (rrmA)
Enzymes [BR:ecr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     ECIAI1_1892 (rrmA)
Ribosome biogenesis [BR:ecr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ECIAI1_1892 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 MTS Methyltransf_4 Ubie_methyltran Methyltransf_32 PrmA DUF938 MetW Methyltransf_29 PCMT Methyltransf_8 Pox_MCEL Methyltransf_2 CheR Methyltransf_9 NodS Rad50_zn_hook
Motif
Other DBs
NCBI-ProteinID: CAQ98746
Structure
PDB: 

Position
complement(1952039..1952848)
Genome map
AA seq 269 aa AA seqDB search
MSFSCPLCHQPLSREKNSYICPQRHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMIQARRA
FLDAGHYQPLRDAIVAQLRERLDEKATAVLDIGCGEGYYTHAFADVLPEITTFGLDVSKV
AIKAAAKRYPQVTLCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPG
PRHLMELKGLIYNEVHLHAPHAEQLEGFTLQQSDELCYPMRLRGDEAVALLQMTPFAWRA
KPEVWQTLAAKEVFDCQTDFNIHLWQRSY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttcctgtccactttgccatcagcctctttcgcgtgaaaaaaacagctatatc
tgtccccagcgacatcagtttgatatggcgaaagaagggtatgtcaatctgctgcccgtt
cagcataaacggtctcgtgatccgggcgacagcgcggaaatgatacaagcacgccgcgca
ttcttagatgccggacattatcagccgctgcgtgatgcaattgtcgcccaactgcgggaa
cggcttgatgaaaaggccacggcggtgctggatattggctgtggtgaagggtattacaca
cacgcatttgccgatgtgttgcccgaaatcaccacgtttggcctggatgtctcgaaggta
gcgataaaagcggcggcgaaacgctatccgcaggtcactctttgtgtcgcttccagccac
cgtttgccgttttccgataccagtatggacgccataatacgtatttacgcgccgtgtaaa
gcagaagaattagcacgagtagtgaagcccggcggctgggtcattactgccacgccggga
ccgcgacatttgatggagctgaaggggctgatttacaatgaagtacatcttcatgcacct
catgcagaacaactggaaggttttacattacagcagagtgatgagttgtgttatccgatg
cgtcttcgcggtgatgaagccgtcgcattattgcagatgacgccgtttgcctggcgtgcg
aagccagaagtctggcaaacactggcagcaaaagaagtgttcgactgccagacggacttt
aatattcacctctggcagcgttcttattaa

DBGET integrated database retrieval system