KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_2341Help
Entry
ECIAI1_2341       CDS       T00828                                 

Gene name
yfbB
Definition
(GenBank) putative thioesterase, menaquinone synthesis
  KO
K08680  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00130  Ubiquinone and other terpenoid-quinone biosynthesis
ecr01100  Metabolic pathways
ecr01110  Biosynthesis of secondary metabolites
Module
ecr_M00116  Menaquinone biosynthesis, chorismate => menaquinol
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ECIAI1_2341 (yfbB)
Enzymes [BR:ecr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     ECIAI1_2341 (yfbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Thioesterase Lipase_3
Motif
Other DBs
NCBI-ProteinID: CAQ99183
UniProt: B7M5U6
Structure
PDB: 

Position
complement(2423779..2424537)
Genome map
AA seq 252 aa AA seqDB search
MILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDG
FDDVTDLLRKTLVSYNILEFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQ
RAERQRSDRQWAQRFCTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAML
EATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPA
GVIASLAQILRF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcacgcgcaggcaaaacacggaaaaccaggtttaccctggctggtgtttttg
cacggtttttccggcgattgccacgaatggcaagaagtgggcgaggcgtttgccgactac
tcacggttgtatgttgatctcccaggtcatggtggttcggcggcgattagcgtcgatgga
tttgatgatgtcaccgacttactgcgtaaaaccttggttagttacaacatccttgaattc
tggctggtggggtactcgcttggcggacgggtggcgatgatggcggcttgccaggggctg
gcggggctttgtggggttattgtcgaaggcgggcatccggggctgcaaaatgctgaacaa
cgtgcggaacgtcagcgttccgatcgccaatgggcgcagcgtttttgcacagaaccgtta
acggcggtatttgccgactggtatcaacagcctgtttttgcctcgctcaatgacgatcaa
cgccgggagctggtggcgctgcgcagcaacaataatggcgcaacccttgccgccatgctg
gaggcgacttctctcgccgtccagcctgatttacgtgctaaccttagtgcccgcacattt
gcgttttattatttatgtggtgaacgtgacagcaaattccgcgccctggcggcggaactg
gctgccgactgccatgtcattcctcgcgccggacataacgcgcatcgggaaaatcccgct
ggcgtaatcgcaagtctggcgcagatcttgcgtttctga

DBGET integrated database retrieval system