KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_2428Help
Entry
ECIAI1_2428       CDS       T00828                                 

Gene name
cscA
Definition
(GenBank) Sucrose-6-phosphate hydrolase (beta-fructofuranosidase) (Sucrase) (Invertase)
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00052  Galactose metabolism
ecr00500  Starch and sucrose metabolism
ecr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECIAI1_2428 (cscA)
   00500 Starch and sucrose metabolism
    ECIAI1_2428 (cscA)
Enzymes [BR:ecr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECIAI1_2428 (cscA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: CAQ99270
Position
2513160..2514602
Genome map
AA seq 480 aa AA seqDB search
MIKMTQSRLHAAQNALAKLHEHRGNTFYPHFHLAPPAGWMNDPNGLIWFNDRYHAFYQHH
PMSEHWGPMHWGHATSDDMIHWQHEPIALAPGDDNDKDGCFSGSAVDDNGVLSLIYTGHV
WLDGAGNDDAIREVQCLATSRDGIHFEKQGVILTPPEGIMHFRDPKVWREADTWWMVVGA
KDPGNTGQILLYRGSSLREWTFDRVLAHADAGESYMWECPDFFSLGDQHYLMFSPQGMNA
EGYSYRNRFQSGVIPGMWSPGRLFAQSGHFTELDNGHDFYAPQSFLAKDGRRIVIGWMDM
WESPMPSKREGWAGCMTLARELSESNGKLLQRPVHEAESLRQQHQSVSPRTISNKYVLQE
NAQAVEIQLQWALKNSDAEHYGLQLGTGMRLYIDNQSERLVLWRYYPHENLDGYRSIPLP
QRDTLALRIFIDTSSVEVFINDGEAVMSSRIYPQPEERELSLYASHGVAVLQHGALWLLG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaatgacgcaatctcgattgcatgcggcgcaaaacgccctagcaaaacttcat
gagcaccggggtaacactttctatccccattttcacctcgcgcctcctgccgggtggatg
aacgatccaaacggcctgatctggtttaacgatcgttatcacgcgttttatcaacatcat
ccgatgagcgaacactgggggccaatgcactggggacatgccaccagcgacgatatgatc
cactggcagcatgagcctattgcgttagcgccaggagacgataatgacaaagacgggtgt
ttttcaggtagtgctgtcgatgacaatggtgtcctctcacttatctacaccggacacgtc
tggctcgatggtgcaggtaatgacgatgcaattcgcgaagtacaatgtctggctaccagt
cgggatggtattcatttcgagaaacagggtgtgatcctcactccaccagaaggaatcatg
cacttccgcgatcctaaagtgtggcgtgaagccgacacatggtggatggtagtcggggcg
aaagatccaggcaacacggggcagatcctgctttatcgcggcagttcgttgcgtgaatgg
accttcgatcgcgtactggcccacgctgatgcgggtgaaagctatatgtgggaatgtccg
gactttttcagccttggcgatcagcattatctgatgttttccccgcagggaatgaatgcc
gagggatacagttaccgaaatcgctttcaaagtggcgtaatacccggaatgtggtcgcca
ggacgactttttgcacaatccgggcattttactgaacttgataacgggcatgacttttat
gcaccacaaagctttttagcgaaggatggtcggcgtattgttatcggctggatggatatg
tgggaatcgccaatgccctcaaaacgtgaaggatgggcaggctgcatgacgctggcgcgc
gagctatcagagagcaatggcaaacttctacaacgcccggtacacgaagctgagtcgtta
cgccagcagcatcaatctgtctctccccgcacaatcagcaataaatatgttttgcaggaa
aacgcgcaagcagttgagattcagttgcagtgggcgctgaagaacagtgatgccgaacat
tacggattacagctcggcactggaatgcggctgtatattgataaccaatctgagcgactt
gttttgtggcggtattacccacacgagaatttagacggctaccgtagtattcccctcccg
cagcgtgacacgctcgccctaaggatatttatcgatacatcatccgtggaagtatttatt
aacgacggggaagcggtgatgagtagtcgaatctatccgcagccagaagaacgggaactg
tcgctttatgcctcccacggagtggctgtgctgcaacatggagcactctggctactgggt
taa

DBGET integrated database retrieval system