KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_2988
Entry
ECIAI1_2988       CDS       T00828                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase, Fe-S binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00230  Purine metabolism
ecr01100  Metabolic pathways
ecr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECIAI1_2988 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: CAQ99803
Position
3061745..3062224
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVQDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttcaggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system