KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_4154Help
Entry
ECIAI1_4154       CDS       T00828                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase, NAD
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00561  Glycerolipid metabolism
ecr00640  Propanoate metabolism
ecr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECIAI1_4154 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    ECIAI1_4154 (gldA)
Enzymes [BR:ecr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     ECIAI1_4154 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CAR00925
Structure
PDB: 

Position
complement(4224427..4225530)
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGADVINRLGEYLKPLAERWLVVGDKFVLGFAQSTVEKSFKDAGLVVE
IAPFGGECSQNEIDRLRGIAETAQCGAILGIGGGKTLDTAKALAHFMGVPVAIAPTIAST
DAPCSALSVIYTDEGEFDRYLLLPNNPNMVIVDTKIVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLLEEGEKAMLAAEQHVVTPALERVIEANTYL
SGVGFESGGLAAAHAVHNGLTAIPDAHHYYHGEKVAFGTLTQLVLENAPVEEIETVAALS
HAVGLPITLAQLDIKEDVPAKMRIVAEAACAEGETIHNMPGGATPDQVYAALLVADQYGQ
RFLQEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcattattcaatcaccgggtaaatacatccagggcgctgatgtgattaatcgt
ctgggcgaatacctgaagccgctggcagaacgctggttagtggtgggtgacaaatttgtt
ttaggttttgctcaatccactgtcgagaaaagctttaaagatgctggactggtagtagaa
attgcgccgtttggcggtgaatgttcgcaaaatgagatcgaccgtctgcgtggcatcgcg
gagactgcgcagtgtggcgcaattctcggtatcggtggcggaaaaaccctcgatactgcc
aaagcactggcacatttcatgggtgttccggtagcgatcgcaccgactatcgcctctacc
gatgcaccgtgcagcgcattgtctgttatctacaccgatgagggtgagtttgaccgctat
ctgctgttgccaaataacccgaatatggtcattgtcgacaccaaaatcgtcgcgggcgca
cctgcacgtctgttagcagcgggtatcggcgatgcgctggcaacctggtttgaagcgcgt
gcttgctctcgtagcggcgcgaccaccatggcgggcggcaagtgcacccaggcggcgctg
gcactggctgaactgtgctacaacaccctgctggaagaaggcgaaaaagcgatgcttgcc
gccgaacagcatgtagtaaccccggcgctggagcgcgtgattgaagcgaacacctatttg
agcggcgttggttttgaaagcggcgggctggcggcggctcacgcggtgcataacggcctg
accgctatcccggacgcgcatcactattatcacggtgaaaaagtggcatttggtacgctg
acgcagctggttctggaaaacgcaccggttgaggaaatcgaaaccgtagctgcacttagc
catgcggtaggtttgccaataactctcgctcaactggatattaaagaagatgtcccggcg
aaaatgcgaattgtggcagaagcggcatgtgcagaaggtgaaaccattcacaacatgcct
ggcggcgcgacgccagatcaggtttacgccgctctgctggtagccgaccagtacggtcag
cgtttcctgcaagagtgggaataa

DBGET integrated database retrieval system