KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0216Help
Entry
ECs0216           CDS       T00048                                 

Definition
(RefSeq) Hcp-like protein
  KO
K06887  uncharacterized protein
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ECs0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-GeneID: 914071
NCBI-ProteinID: NP_308243
UniProt: Q8X7X3
Position
complement(243533..244012)
Genome map
AA seq 159 aa AA seqDB search
MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFMHGLNRDQNVNHHHLT
IKKPIDKASPLLGKAICDNELLTCDFSFYRTNKFGINELFYKIKLTGAKISDIHVSISHI
VVDNSVQPEESVSFSYESIIWEHCSAGTSAYSLWEDRLF
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttaatttatttaacactaaatggtgataatcaagggctcatttcaagtggt
tgttcatcacaaccatccattggaaataaagctcaaacagcacacattgatcaaattatg
atttatgaattcatgcatggattaaatcgagatcaaaacgtcaaccatcatcatttgaca
ataaaaaaacctatagataaagcatcacccttattaggcaaagcaatttgcgacaatgaa
ttattgacatgtgatttttccttttatcgtacaaataaatttggaattaatgaactgttc
tataaaatcaaattaactggagcaaagataagcgacattcatgtctctatatcacatatt
gttgttgataacagcgttcaacccgaagagtcagtttctttcagttatgagtcaattata
tgggagcattgttccgctggcactagtgcatacagtttatgggaagatcgtcttttttaa

DBGET integrated database retrieval system