KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0217Help
Entry
ECs0217           CDS       T00048                                 

Definition
(RefSeq) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecs02044]
    ECs0217
Secretion system [BR:ecs02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECs0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VasL ImpA_N
Motif
Other DBs
NCBI-GeneID: 914077
NCBI-ProteinID: NP_308244
UniProt: A0A0H3JBT0
Position
complement(243978..245387)
Genome map
AA seq 469 aa AA seqDB search
MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDL
HTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNIL
RQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSN
TENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVRSLTENPPQASVIKQGSTV
RGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAATVWMASPELENYERRLQQLL
DTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLRGWLQTRQDLH
AFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYQDARAQKQNTDALEKQI
NERLEGVLSRWLLLKNNTIPTIKKALNFNNIHEYKGVLNGEFNLFNTKW
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaacgtactgacacaaactatcgttaccggcagtgacccgcgcgggctgccg
gaattcagcgccatccgcgaggaaataaacaaagccagccacccgtcacagcctgagctg
aactggaaactggtggagtcgctggcgctggcgatttttaaagccaacggtgtggattta
cacaccgccacctactatacgcttgcccggacacggacacagggactggcgggattctgc
gaaggtgcggaactgctggcggcaatggtaagccacgactgggataagttctggccgcag
ggcggcccggcgcgtactgaaatgctggactggtttaactcccgaaccggcaatattctg
cgtcagcaaatctcctttgcggaatccgacctaccactgatctaccgcacagagcgggca
ttgcagcttatctgcgataagctccagcaggtggaactgaagcgcgttccgcgcgtggag
aatctgctctattttatgcagaacacgcgtaaacggcttgaaccccagctgaagagtaac
actgagaacgccgcacagaccacggtcagaacgctgatttatgccccggaaacacaggca
tcttccacaccagaagcggtagtgcctcccctgcccggcctgcctgagatgaaagtggaa
gtgcgcagtctgacagagaatcccccacaggccagtgtgataaagcaaggcagtacggta
agagggtttatcgcagggatcgcctgttcagtggctgtcgcctcagcattgtggtggtgg
caggtctatccggtgcagcagcaactgttacaggttaacgacaccgctcagggcgcagca
acggtgtggatggcctcacctgaactcgaaaactatgagcgcaggctgcaacaacttctt
gatacctccccggtacagccgctggaaaccgggatgcagatgatgcgtgttgccgacagt
cgctggccggaaagcctgcaacagcaacaggcctcgacacaatggaatgaggcactcaaa
acccgcgcacagagtagcccgcagttgcgtggctggttgcagacccgccaggacttacat
gcttttgcagatctagtgatgcagcgcgagaaagagggactaaccctttcctatatcaaa
aatgtcatctggcaggcggagcggggactggggcaggaaacacccgttgagtctctgttg
acgcagtaccaggatgcccgtgcgcagaagcagaatacagatgcgctggaaaaacaaatt
aatgagcgactcgaaggcgtgttaagccgctggctgctgctgaagaataatacgataccg
acgataaaaaaagcattgaatttcaataacattcatgaatacaaaggagttttaaatggc
gaatttaatttatttaacactaaatggtga

DBGET integrated database retrieval system