KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0227
Entry
ECs0227           CDS       T00048                                 

Definition
(RefSeq) hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecs02044]
    ECs0227
Secretion system [BR:ecs02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   ECs0227
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-GeneID: 914116
NCBI-ProteinID: NP_308254
UniProt: A0A4P8BDF8 A0A152V9Q1
Position
complement(256526..257806)
AA seq 426 aa
MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHAPECHWSVQDRQQSIPAQAFTVI
LHDGTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEM
ATPETIVTNRDMLTDTLLSTEGAPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTG
DPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIYASPGDHNDDISAAEMAQRHLAVTPL
LRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKGLLDLQQQRNSLSDKHLRPLEDNPLRLN
MDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRVLLDAFSPQNL
LRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVYDRVLREK
QREPEA
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgccggaagagaaactacagacgctttcattgcaggtcattaacggcagtgagctggaa
agcgggcgggcggcgcgctgtctgttcacacagcagggaaatgtcggccatgcccccgaa
tgccactggtcggtacaggatcgtcagcagagcattccggcccaggcttttaccgttatc
ctgcacgatggcacattttgtctacgcccgcagacggcacaactgtggctgaatcaggca
aaagtcacagcaacatcagacctgatacagttgcgccagggcgatgagatccagatcgga
cggctgatggtgagggttcatctgaaccggggagatattccccattacgatgaggaaatg
gccactcccgaaaccatcgttaccaatcgcgatatgctcacggataccctgctatcaacg
gagggtgcgccacactatccgggaatgactcaccggcaccagcttgcagacaccgtggta
aatggtttttctgccgatccactccaggcacttcagtccgaaagcctgattaccacgggc
gatccgctttcaggcattgcggctgtccggccatcggcaccgctgtccgatccggcaagt
aatggggggatcaatactccgtttatggatctgccgcccatttatgccagccctggcgat
cataatgatgacatctctgcggcagaaatggcgcaacgccaccttgcggtcaccccctta
ctgcgcggtcttggcggctcgcttaccgtgagcaattccgacgatgcggatgattttctg
gaggaggccggacgaacgttacaggccgcaataaaaggtctgctcgatttgcagcagcag
cgtaacagcctctcagacaaacatttgcgcccgctggaagataacccgctgcgcctgaac
atggattacgccaccgcgctcgacgtgatgtttgccgaaggtaaaagcccggtacatctg
gcggctcccgccgccgtcagtgaaagcctgcgcaatgtccgccaccacgaagaagctaac
cgggcggcgattgtggagtcgcttcgtgtcctgctggatgctttctcaccacaaaatctg
ctgcgccgctttgtgcagtaccgccgcagccatgaactgcgccagccgctggatgatgcc
ggagcatggcaaatgtacagccattattacgaagaactggcctccgatcgccagcagggg
tttgagatgctgtttaacgaggtctacgcccaggtctatgaccgggtgcttcgtgaaaaa
cagcgggagccggaagcatga

DBGET integrated database retrieval system