KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0236
Entry
ECs0236           CDS       T00048                                 

Definition
(RefSeq) protein VgrG
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECs0236
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecs02044]
    ECs0236
Secretion system [BR:ecs02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECs0236
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-GeneID: 914167
NCBI-ProteinID: NP_308263
UniProt: A0A0H3JC38
Position
264861..267002
AA seq 713 aa
MSTGLRFTLEVDGLPPDAFAVVFFHLNQSLSSLFSLALSLVSQQFLSLEFQQILDKMAYL
TIWQGDDVQRRVKGVVTWFELGENDKNQKLYSMKVCPPLWRTGLRQNFRIFQNEDIASIL
GTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAEEGIFFYEEHAQKSTDQS
LVLCDTVLYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRPSSVVTKDYTFKRPGWAGR
FDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWRNNAEVARGTSRSPEIWPGR
RIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTTLDNHFAVIPADRTWRPQPLL
KPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNPSNQDSSCWIRVAQAWAGTGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPGSLPGTKTQMTIRSKTYKGSGFN
ELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNHAEKIGNNQAITVTNNQILNIGVN
QIQTVGVNQVETVGSNQIIKVGSNQVEKVGIIRALTVGVAYQTTVGGIMNTSVALLQSSQ
VGLHKSLMVGMGYSVNVGNNVTFSVGKTMKENTGQTAVYSAGEHLELCCGKARLVLTKDG
SIFLNGTHIHLEGESDVNGDAPVINWNCGATQPVPDAPVPKDLPPGMPDMRQF
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgtcaaccggattacgtttcacgctggaagtggacggcctgccaccggatgcttttgcg
gtggtcttctttcatctgaaccagtcactctcttcgcttttttccctcgctctctctctg
gtcagccagcagtttctctcccttgaattccagcagatcctcgacaaaatggcctacctg
acgatatggcagggcgatgacgtacagcgccgggtgaaaggtgtggtgacctggtttgaa
ctgggggagaacgacaaaaaccagaagctgtacagcatgaaggtgtgcccgccgctgtgg
cgcacagggctgcgccagaacttccgtatcttccagaatgaggacatcgcaagcatcctc
ggcacgatattgcaggaaaacggggtgaccgagtggagcccgctgttcagcgagccacat
ccttcccgtgagttttgtgtccagtacggtgagactgattacgatttcctgtgccggatg
gcggcggaggaaggcatcttcttttatgaggagcacgcgcaaaaaagtaccgaccagagc
ctggtcctgtgcgataccgtgctttatctgccggagtcctttgagatcccctggaatccg
aacacccgtaccgaggtaagcaccctctgcatcagccagtttcgctacagcgcacaaatc
cgcccttcttccgtggtgaccaaagactacacctttaaacgccccggctgggccggacgt
tttgaccaggaaggccagcaccaggattaccagcgcacacagtatgaagtgtatgactat
cccggacgtttcaagggcgcccacgggcagaactttgcccgctggcagatggacggctgg
cgaaacaacgcagaagtggcgcgcggaacaagccgttcgccggagatatggccgggacgg
cgaattgtgctgacggggcatccgcaggcgaacctgaaccgggaatggcaggtggtggca
agtgaactgcacggtgagcagccgcaggcggtgccgggacgcaggggttcaggcaccacg
ctggataaccattttgcggtaataccggcagacagaacatggcgaccacagccgttgctg
aaaccgctggtggacggcccgcagagcgccgtcgtgacgggaccggcaggcgaggaaatc
ttctgtgatgaacatggccgcgtgcgggtgaaatttaactgggaccgctataacccgtca
aaccaggacagttcatgctggatccgtgtggcacaggcgtgggcaggcaccgggtttggt
aacctggcgataccgcgtgtgggtcaggaggtcattgtggacttcctcaacggcgatccg
gaccagccgatcattatggggcgtacctaccaccaggaaaaccgcacacccggtagcctg
ccggggacgaagacgcagatgaccattcgttcgaaaacctataagggcagcgggtttaat
gaactgaagtttgacgatgcgacagggaaagaacaggtctacatccacgcgcagaagaac
atgaacaccgaggtgctgaataaccgcaccacggatgtgataaacaaccatgccgaaaaa
ataggtaacaaccaggcgatcaccgttaccaataaccagatcctgaacattggcgttaat
cagatacagacggttggtgtcaaccaggtggaaacggtaggcagtaaccagattatcaaa
gtgggatcaaaccaggttgaaaaggtggggatcattcgtgcgctgacggtgggtgtggcg
tatcagacgacggtaggcggcattatgaatacctcggtggcgttgttgcagtcctcacag
gtagggctgcataaatcactgatggtgggaatgggctacagcgtcaatgtagggaataac
gtcaccttctcggtgggcaagacgatgaaggaaaacaccggacaaacagcagtttattct
gccggtgagcatcttgaactctgctgtggtaaggcaaggctggtgctgacgaaggacgga
agcatatttcttaatggtacgcacattcatctggaaggggagtcggatgtgaacggtgat
gcgccggtgattaactggaactgtggtgccacacaacctgtaccggatgcgcctgtgccg
aaagatttaccccccggaatgccggatatgcggcaattttga

DBGET integrated database retrieval system