KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0237Help
Entry
ECs0237           CDS       T00048                                 

Definition
(RefSeq) RhsG core protein with extension
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHS_repeat RHS UPF0257
Motif
Other DBs
NCBI-GeneID: 914169
NCBI-ProteinID: NP_308264
UniProt: Q8XED9
Position
267078..271292
Genome map
AA seq 1404 aa AA seqDB search
MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITYANPVNPVLGAKVLPG
ETDLALPGPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQIRDEGLILNDNGGRS
IHFEPLFPGEISYSRSESFWLARGGVAEQHSSQPLSALWQVLPEDVRLSPHMYLATNSLQ
GPWWILNWPERVPGADEVLPPEPPAYRVLTGVVDGFGRTLAFHRAAEGDVAGAVTGVTDG
AGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSLVFPDTLPAGTEYGADNGIRL
EAVWLTHDPAYPDELPAAPLARYTYTASGELRAVYDRSGTQVRGFAYDAEHAGRMVAHHY
AGRPESRYRYDDTGRVTELVNPEGLDYRFEYGQDRVTITDSLNRREVLYTEGEGGLKRVV
KKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMASGAVTAVTGPDGRTVRYGYNSQ
RQVTSVTYPDGLRSSREYDEKGRLAAETSRSGETTRYSYDDPASELPTGIQDATGSTKQM
AWSRYGQLLTFTDCSGYTTRYEYDRYGQQIAVHREEGISTYSSYNPRGQLVSQKDAQGRE
TRYEYSAAGDLTAIVAPDGSRSEIQYDAWGKAVSTTQGGLTRSMGYDAAGRITVLTNENG
SQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKLTQSEDEGLVTLWHYDASDRITHRTVN
GDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGYDDKGRLTGERQTVENPETGEMLWEHET
GHAYSEQGLATRQEPDGLPPVEWLTYGSGYLAGMKLGGTPLVEYMRDRLHRETARSFGGE
AYELATAWNTSGQLRSRHLNLPQLDRDYDWNDNGQLIRISGPQESREYRYSDTGRLTGVH
TTAANLDIDIPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYVYRYDEYGRLAEKT
DRIPEGVIRMHDERTHHYHYDSQHRLVFHTRIQHGEPQVESRYLYDPLGRRTGKRVWRRE
RDLTGWMSLSRKPEETWYGWDGDRLTTVQTQQTRIQTVYQPGSFTPLLRIETENGEQAKA
RHRSLAEVLQEDTGVTLPAELAVMLGRLERELRQGSVSEESQQWLAQCGLTAEQMGAQLE
AGYIPERKLHLYHCDQRGLPLGLISPGRETALTAEYDEWGNLLSETSAQPLQQSLRFPGQ
QYDEESGLYYNRNRYYDPLQGRYITQDPIGLEGGWNLYQYPLNPIEHIDPLGLALDLNYY
SPSDPIYKGSLNVREFPTGFTVGGHGSPTSMSDDRIKKGSDLTIKQLASDIRANPKYHEG
MPVVLFSCETGKGKNSFAQKLANELDATVIAPDEIIWIWPDGNYAIMGQTARITIGGKDN
GVFELVPDEKQPGDFHKFTPTGSK
NT seq 4215 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaaaaccggcggcgcggcagggtgacatgacccgcaagggactggatattgtg
cagggttcagcaggggtgctgataggtgcgccgacgggcgtggcctgctcggtgtgtccg
ggagggattacctatgctaacccggtgaacccggtgctgggtgcgaaggtgctgccgggc
gagacggaccttgcgctgcccggcccgctgccgtttattctttcccgcgcctacagcagc
taccggaccagaacacccgcgccggtgggggtgtttggtcccggctggaaagcgcccttc
gatatccgcttacagatacgcgatgaaggcctgatactcaacgacaacggcggcaggagc
attcactttgagccgctgtttcccggcgagataagctacagccgcagcgagtcgttctgg
ctggcgcggggcggggtggcggagcagcacagttcgcagccgctaagcgcgctctggcag
gtgctgccggaagatgttcgcctgagtccgcatatgtacctggcgacaaacagccttcag
gggccgtggtggatactcaactggccggagcgggtgccgggggcggacgaggtgctgccg
ccggagccgcccgcataccgggtgctgacgggcgtggtggatggcttcgggcggacgctg
gcctttcaccgggcggcggagggtgatgtggcgggcgcggtgacgggggtgacggacggc
gcgggccgccgttttcacctggtgctgaccacacaggcacagcgggcggaagtattccgt
aaacagcgcgccacgtctttatcttcccctgccggtccccgttctgcttcctcttctctg
gttttccccgacacgctgcccgccggtacagaatacggtgccgataacggtatccggctg
gaggcggtatggctgacacacgacccggcatacccggatgaactgcccgccgcgccgctg
gcgcgctacacgtacacggccagcggagaactgcgggcggtgtatgaccgcagcgggacg
caggtgcgcgggtttgcttatgatgcggagcacgccgggcggatggtggcgcaccattat
gcgggtaggccggagagccgctaccggtatgatgataccggccgggtgacggagctggtc
aacccggaggggctggactaccgctttgagtacgggcaggaccgtgtgaccatcacggac
agcctgaaccggcgggaggtgctgtacacggaaggcgagggtggcctgaaacgtgttgtg
aagaaggaacatgcggacgggagcatcacccgcagcgagtatgatgaggcggggaggctg
aaggcacagacggatgcggcgggacggcggacggagtacagcctgcatatggcgtcgggt
gcggtgacagcggtgacggggccggacggcaggacggtgcggtatggctataacagccag
cggcaggtgacgtcagtgacgtacccggacgggctgcgcagcagccgggagtatgatgag
aagggaaggctggcggcggagacctcgcgcagcggagagacgacgcggtacagctatgat
gacccggcgagtgagctgccgacagggatacaggacgcgacgggcagtacaaaacagatg
gcatggagccgttacggtcagctgctgacctttacggactgctcggggtacacgacgcgg
tatgagtatgaccggtacggtcaacaaatcgccgttcaccgggaagaaggcatcagcact
tacagcagttataacccgcgtggccaactggtcagtcagaaggatgcgcaggggcgtgaa
acccgttatgagtacagcgccgcaggcgacctcaccgctatcgttgccccggacggcagc
cgcagtgagatacagtatgatgcgtggggaaaggccgtcagcaccacgcagggcggtctg
acgcgcagcatggggtatgacgctgccgggcgcatcaccgtgctgaccaacgagaacggc
agccagtccacgttccggtatgacccggtggacaggctgactgaacagcgcggttttgat
ggccggacgcaacgttaccactatgacctgaccggaaaactcacgcagagtgaagacgag
gggcttgtcaccctctggcactacgatgcgtcggaccgcatcacgcaccggacggtgaac
ggcgacccggcagagcagtggcagtatgatgagcacgggtggctaaccaccctcagccat
accagtgaaggccaccgggtgtcggtccactacggctatgacgataaaggccgcctgacg
ggtgaacggcagacggtggagaacccggagacgggggagatgctgtgggagcatgagacg
gggcacgcgtacagcgaacaggggctggcgacccgtcaggagccggacggtctgccgccg
gtagagtggctgacgtatggcagcggttatcttgcggggatgaagctgggcggaacgcca
ctggtcgagtacatgcgggaccggctgcaccgtgagacggcccgcagcttcggcggggag
gcatatgaacttgccaccgcctggaataccagcggccagctccggagcaggcacctgaac
cttccgcagcttgaccgtgactacgactggaacgacaacggacagctaatccgcatcagc
ggcccgcaggagagccgggagtaccgttacagtgacacgggaaggctgacgggcgtccac
accacggcagcgaacctggatatcgatatcccgtatgcaacggacccggcaggaaaccgg
ctgccggacccggaactgcacccggacagcaccctcacggcatggccggataaccgcatc
gcggaagatgcgcactatgtctaccgctacgatgaatacggcaggctggcggagaagacg
gaccgcatcccggaaggggttatccggatgcacgacgagcgcacccaccactatcactac
gacagccagcaccgcctggtgttccacacgcggatacagcacggcgaaccacaggtggag
agccggtacctctatgacccgctgggccgccggacgggaaaacgggtgtggcggcgggag
cgtgacctgacggggtggatgtcgctgtcgcgtaaaccggaggagacctggtacgggtgg
gacggtgacaggctgaccactgtacagacccaacagacaagaatccagacggtataccag
ccgggaagcttcacgccgctcctgagaatcgaaacagagaatggtgaacaggcgaaggcg
cggcaccgtagcctggcggaggtgttgcaggaggacacgggtgtgacgctaccggcggag
ctggcggtgatgctgggaaggctggagcgggagctgcggcagggcagcgtgagtgaagaa
agccagcagtggcttgcgcagtgcgggctgacggcggagcagatgggcgcgcagctggag
gcgggatacatcccggagaggaaacttcatctttaccactgcgaccaacggggactgccg
ctggggctcatcagcccgggaagggagacggcgttgactgcggagtatgacgagtgggga
aacctgctgagcgaaaccagcgcgcagccccttcaacagtcactccgtttcccgggccag
cagtatgatgaggagtcggggctgtactacaaccgcaaccggtactatgatccgttgcag
gggagatatatcacccaggacccgatagggctggaggggggatggaacctgtatcagtac
ccactcaatcctattgaacatatagatccgttggggttagcacttgatttgaattattat
tctccgtcagatcctatatataaaggttctcttaatgtaagggaatttccaacgggtttt
acagttggaggtcatggttcgcctacatctatgagtgatgacagaatcaaaaaaggaagt
gatctgacaataaaacaattagctagcgacataagagcgaatcctaaatatcatgaaggt
atgcctgtagtcttgttttcctgcgaaacaggaaaaggcaaaaattcatttgcacagaaa
ctagctaacgaacttgatgctacagtgattgctcctgatgaaataatatggatttggccg
gatggaaactatgctattatggggcaaacagctaggataacaataggcggtaaggacaac
ggggtgtttgaattggtgccagacgagaaacaaccaggggactttcataagtttacacct
acaggaagcaaatag

DBGET integrated database retrieval system