KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0773
Entry
ECs0773           CDS       T00048                                 

Name
(RefSeq) colicin uptake protein TolR
  KO
K03560  biopolymer transport protein TolR
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecs02000]
    ECs0773
Transporters [BR:ecs02000]
 Other transporters
  Pores ion channels [TC:1]
   ECs0773
SSDB
Motif
Pfam: ExbD
Other DBs
NCBI-GeneID: 917504
NCBI-ProteinID: NP_308800
UniProt: P0ABV8
Structure
PDB: 
5BY4

Position
860355..860783
AA seq 142 aa
MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEVDLPDATESQAVSSND
NPPVIVEVSGIGQYTVVVEKDRLERLPPEQVVAEVSSRFKANPKTVFLIGGAKDVPYDEI
IKALNLLHSAGVKSVGLMTQPI
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccagagcgcgtggacgaggtcgtcgcgatctcaagtccgaaatcaacattgtaccg
ttgctggacgtactgctggtgctgttgctgatctttatggcgacagcgcccatcatcacc
cagagcgtggaggtcgatttgccagacgctactgaatcacaggcggtgagcagtaacgat
aatccgccagtgattgttgaagtgtctggtattggtcagtacaccgtggtggttgagaaa
gatcgcctggagcgtttaccaccagagcaggtggtggcggaagtgtccagccgtttcaag
gccaacccgaaaacggtctttctgatcggtggcgcaaaagatgtgccttacgatgaaata
attaaagcactgaacttgttacatagtgcgggtgtgaaatcggttggtttaatgacgcag
cctatctaa

DBGET integrated database retrieval system