KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0956Help
Entry
ECs0956           CDS       T00048                                 

Definition
(RefSeq) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00260  Glycine, serine and threonine metabolism
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
ecs01120  Microbial metabolism in diverse environments
ecs01130  Biosynthesis of antibiotics
ecs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECs0956
Enzymes [BR:ecs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ECs0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 CheD
Motif
Other DBs
NCBI-GeneID: 917698
NCBI-ProteinID: NP_308983
UniProt: P58319
Structure
PDB: 

Position
complement(1039405..1040406)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKI
KPDDIHFARTKLLSLENTHNGKVLPREYLKDAWEFTRERNLALHVDGARIFNAVVAYGSE
LKELTQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMY
ALKNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL
INASPIVRLVTHLDVSREQLAEVAAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgtaacccgaccgagccgcgccatgctcgaagcgatg
atggccgccccggttggggacgacgtttacggagacgaccctaccgttaatgctctgcag
gactatgcagcagagctttccggtaaagaagccgccatttttctgcctaccggcactcag
gccaacctggtcgctctgctcagtcactgcgaacgcggcgaagagtatattgtcggtcag
gccgcgcataactatctgtttgaagccggtggcgcggcggtgctgggcagtattcaaccg
caacccatcgacgcggctgccgacggcacgctaccgctggataaagtggcgatgaaaatc
aaacccgacgatatccatttcgcccgcaccaaattactcagtctggaaaacacccacaac
ggcaaagtgttgccgcgtgaataccttaaagatgcatgggaatttacccgcgagcgcaat
ctggcgctgcatgttgacggtgcgcgcatctttaatgccgtggtggcttacggcagcgaa
ctgaaagagctcacgcaatattgtgattcgttcaccatttgcctgtcgaaaggtcttggg
acgccagtcggttcattactcgtcggtaatcgtgattacattaaacgtgccattcgctgg
cggaaaatgacaggtggcgggatgcgccagtccggcattctggctgccgccgggatgtat
gcgctgaaaaataacgtcgcacggttgcaggaagatcacgacaacgccgcctggatggcg
gagcaactgcgtgaagcaggcgcggatgtgatgcgtcaggacactaatatgctgtttgtt
cgcgtcggcgaagaaaatgctgccgcgttaggcgaatacatgaaagcgagaaacgtactg
attaacgcctcgccgattgtccgcctggtgacccatcttgacgtctcgcgcgaacaactg
gcagaagtcgccgcccactggcgcgcattcctggcgcgttaa

DBGET integrated database retrieval system