KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs1324Help
Entry
ECs1324           CDS       T00048                                 

Gene name
ureC
Definition
(RefSeq) urease subunit alpha
  KO
K01428  urease subunit alpha [EC:3.5.1.5]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00220  Arginine biosynthesis
ecs00230  Purine metabolism
ecs01100  Metabolic pathways
ecs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECs1324 (ureC)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ECs1324 (ureC)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    ECs1324 (ureC)
Enzymes [BR:ecs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     ECs1324 (ureC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Urease_alpha Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 913507
NCBI-ProteinID: NP_309351
UniProt: Q8XAG0
Position
1391898..1393604
Genome map
AA seq 568 aa AA seqDB search
MMSNISRQAYADMFGPTTGDKIRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQ
MLSAGCADLVLTNALIIDYWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGVSTEII
AAEGRIVTAGGVDTHIHWICPQQAEEALTSGITTMIGGGTGPTAGSNATTCTPGPWYIYQ
MLQAADSLPVNIGLLGKGNCSNPDALREQVAAGVIGLKIHEDWGATPAVINCALTVADEM
DVQVALHSDTLNESGFVEDTLTAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTN
PTLPYTVNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRQETIAAEDVLHDLGAFSLTSS
DSQAMGRVGEVVLRTWQVAHRMKVQRGPLPEESGDNDNVRVKRYIAKYTINPALTHGIAH
EVGSIEVGKLADLVLWSPAFFGVKPATIVKGGMIAMAPMGDINGSIPTPQPVHYRPMFAA
LGSARHRCRVTFLSQAAAANGVAEQLNLHSTTAVVKGCRTVQKADMRHNSLLPDITVDSQ
TYEVRINGELITSEPADILPMAQRYFLF
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtaatatttcacgccaggcctatgctgacatgttcggccctaccaccggtgat
aaaattcgtctggcagacactgagctgtggatcgaggtcgaagatgatttaactacctac
ggcgaagaggtcaaattcggcggcggtaaagtaatccgcgacggtatgggacaggggcaa
atgctctccgccggctgcgctgatctggtgctgaccaatgccctgatcatcgattactgg
gggatcgttaaagccgatatcggcgtcaaagatggaaggatatttgctatcggcaaagcc
ggtaatcctgatatacaacccaacgtcactatcccaatcggcgtatccacggaaattatt
gccgcagaaggcaggatcgttaccgcaggtggcgtcgatacgcatattcactggatctgc
ccacagcaggctgaagaagcgctgacatccggcattaccaccatgatcggtggcggtact
ggcccgacagcgggttctaacgccacaacctgtaccccaggaccatggtacatttatcaa
atgctgcaggctgcagacagcctgccggtcaatatcgggttgctgggtaaaggcaattgc
tccaatccggatgcgcttcgtgagcaggtcgcggccggggttatcggcctcaaaattcac
gaagactggggagctacacctgcggtaatcaactgcgcactgactgtagccgacgaaatg
gacgttcaggttgcgctacacagtgatacgcttaacgaatcaggattcgttgaggatact
ctgactgccatcggcgggcgcactatccataccttccatacagaaggtgcaggtggtggt
catgctccggatattatcaccgcctgcgcgcaccccaatattctgccttcctcaaccaat
ccgacgctaccctataccgtcaacactattgatgagcatctggacatgctgatggtttgc
catcatcttgacccggatatcgccgaggacgtagcctttgccgaatcgcgcattcgccag
gaaaccattgccgcggaagacgtcctgcacgaccttggcgcgttctccctcacctcgtcc
gattcgcaggccatgggacgcgtcggagaagtagtgttacgaacctggcaggtggcacac
cggatgaaagttcagcgcggcccgttaccggaagaaagtggtgataacgacaacgtccgc
gtgaagcgctatatcgctaaatacaccattaatccggcattaacccacggtattgctcat
gaagtcggctcgattgaagtgggaaaactggcggatctggtgctctggtccccggcgttc
tttggcgtaaaaccggcgactatcgtcaaaggcggaatgatagccatggcgccgatgggt
gatatcaacggctctatccccacaccgcagccggtgcactatcgcccaatgttcgctgca
ttgggcagtgcccgtcaccgctgtcgtgtgactttcctgtcgcaggcagcagcagcaaat
ggcgtcgctgaacagcttaacctgcacagcacaactgctgtggtaaaaggctgccgcaca
gtacaaaaagccgatatgcgccacaacagcctgttgcctgatataaccgtggattcacaa
acctacgaagtgcgtatcaacggcgaactgataaccagtgaaccggcggacattctgcca
atggcgcaacgttatttcctgttttaa

DBGET integrated database retrieval system