KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs1832Help
Entry
ECs1832           CDS       T00048                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00260  Glycine, serine and threonine metabolism
ecs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
ecs01130  Biosynthesis of antibiotics
ecs01230  Biosynthesis of amino acids
Module
ecs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECs1832 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECs1832 (trpA)
Enzymes [BR:ecs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECs1832 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-GeneID: 912862
NCBI-ProteinID: NP_309859
UniProt: Q8X7B5
Structure
PDB: 

Position
complement(1817436..1818242)
Genome map
AA seq 268 aa AA seqDB search
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADTLELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPKKMLAALKAFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcacgctcggtgatccgggcattgagcagtcgctgaaaattatcgatacgcta
attgaagccggtgctgacacgctggagttaggcatccccttctccgacccactggcagat
ggcccgacgattcaaaacgccacactgcgtgcctttgcggcaggtgtgaccccggcgcag
tgctttgagatgctggcactcattcgccagaaacacccgaccattcccattggcctgctg
atgtatgccaacctggtgtttaacaaaggcattgatgagttttatgcccagtgcgagaaa
gtcggcgtcgattcggtgctggttgccgatgtgccagttgaagagtccgcgcccttccgc
caggccgcgttgcgtcataatgtcgcacctatcttcatctgcccgccaaatgccgatgac
gacctgctgcgccagatagcctcttacggtcgtggttacacatatttgctgtcacgagcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggttgcgaagctg
aaagagtacaacgcggcacctccattgcagggatttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttctgcgattgttaaaatc
atcgagcaacatattaatgagccaaagaaaatgctggcggcactgaaagcttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system