KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs1833Help
Entry
ECs1833           CDS       T00048                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00260  Glycine, serine and threonine metabolism
ecs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
ecs01130  Biosynthesis of antibiotics
ecs01230  Biosynthesis of amino acids
Module
ecs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECs1833
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECs1833
Enzymes [BR:ecs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECs1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 912860
NCBI-ProteinID: NP_309860
UniProt: Q8X7B6
Structure
PDB: 

Position
complement(1818242..1819435)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggctcagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcgctgacc
aaatgccagaacattacggctggcacgaacaccacgctgtatctgaagcgcgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctcggtcaggctttactggcgaagcgg
atgggtaaaaccgaaatcatcgccgaaaccggggccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggggccaaagacgttgaa
cgccagtcgcctaacgtttttcgtatgcgtttaatgggtgcggaagtgatcccggtgcat
agcggttccgcgacgctgaaagatgcctgtaacgaggcgctgcgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggcaccgcagctggcccacatccttatccgaccatt
gtccgtgagtttcagcggatgattggcgaagaaaccaaagcacagattctggaaagagaa
ggtcgcctgccggatgccgttatcgcctgtgttggcggcggttcgaatgccatcggcatg
tttgcagatttcatcaacgaaaccaacgtcggcctgattggtgtggagcctggtggtcac
ggtatcgaaactggcgagcacggcgcaccgctaaaacatggtcgcgtgggtatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcagattgaagaatcttactccatc
tccgccggactcgattttccgtccgtcggcccacaacacgcgtatcttaacagcactgga
cgcgctgattatgtgtcaattaccgatgatgaagcactggaagccttcaaaacgctgtgc
ctgcacgaagggattatcccggcgctggaatcctcccacgccctggcccatgcgctgaaa
atgatgcgcgaaaacccggaaaaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system