KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs2021Help
Entry
ECs2021           CDS       T00048                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00620  Pyruvate metabolism
ecs00630  Glyoxylate and dicarboxylate metabolism
ecs01100  Metabolic pathways
ecs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECs2021
   00630 Glyoxylate and dicarboxylate metabolism
    ECs2021
Enzymes [BR:ecs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     ECs2021
    1.2.1.22  lactaldehyde dehydrogenase
     ECs2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-GeneID: 917220
NCBI-ProteinID: NP_310048
UniProt: Q8X9U1
Structure
PDB: 

Position
2005740..2007179
Genome map
AA seq 479 aa AA seqDB search
MSVPVQHPMYIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEW
EALPAIERASWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWAR
RYEGEIIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEF
TPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMAT
AAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQ
FVNRLGEAMQAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVALGGKAVEG
KGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNL
NVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacccgttcaacatcctatgtatattgatggacagtttgttacctggcgtgga
gacgcatggattgatgtggtaaaccctgctacagaggctgtcatttcccgcattcccgat
ggtcaggccgaggatgcccgtaaggcaatcgatgcagcagaacgtgcacaaccagaatgg
gaagcgttgcctgcaattgaacgcgccagttggttgcgcaaaatctccgccgggatccgc
gaacgcgccagtgaaatcagtgcgctgattgttgaagaagggggcaagatccagcagctg
gctgaagtcgaagtggcttttactgccgactatatcgattacatggcggagtgggcacgg
cgttacgagggcgagattattcaaagcgatcgtccaggagaaaatattcttctgtttaaa
cgtgcgcttggtgtgactaccggcattctgccgtggaacttcccgttcttcctcattgcc
cgcaaaatggctcccgctcttttgactggtaataccattgtcattaaacccagtgaattt
acgccaaacaatgcgattgcattcgccaaaatcgtcgatgaaataggccttccgcgcggc
gtgtttaaccttgttctggggcgtggtgaaaccgttgggcaagaactggcgggtaaccca
aaggtcgcaatggtcagtatgacaggcagcgtctctgcaggtgagaagatcatggcgact
gcggcgaaaaacatcaccaaagtgtgcctggaactggggggtaaagcaccagctatcgta
atggacgatgccgatcttgaactggcagtcaaagccatcgttgattcacgcgtcattaat
agtgggcaagtgtgtaactgtgcagaacgtgtttatgtacagaaaggcatttatgatcag
ttcgtcaatcggctgggtgaagcgatgcaggcggttcaatttggtaaccccgctgaacgc
aacgacattgcgatggggccgttgattaacgccgcggcgctggaaagggtcgagcaaaaa
gtggcgcgcgcagtagaagaaggggcgagagtggcgttgggtggcaaagcggtagagggg
aaaggatattattatccgccgacattgctgctggatgttcgccaggaaatgtcgattatg
catgaggaaacctttggcccggttctgccggtagtcgcatttgacacgctggaagatgct
atctcaatggctaatgacagtgattacggcctgacctcatcaatctatacccaaaatctg
aacgtcgcgatgaaagccattaaagggctgaagtttggtgaaacttacatcaaccgtgaa
aacttcgaagctatgcaaggcttccacgccggatggcgtaaatccggtattggcggcgca
gatggtaaacatggcctgcatgaatatctgcagacccaggtggtttatttacagtcttaa

DBGET integrated database retrieval system