KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs2337Help
Entry
ECs2337           CDS       T00048                                 

Definition
(RefSeq) electron transport complex protein RnfB
  KO
K03616  Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.2.1.2]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECs2337
Enzymes [BR:ecs01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.1  Linked to oxidoreductase reactions
    7.2.1.2  ferredoxin---NAD+ oxidoreductase (Na+-transporting)
     ECs2337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 FeS Fer4_7 Fer4_9 Fer4_16 Fer4_6 Fer4_2 Fer4_10 Fer4_3 Fer4_17 Fer4_22 Fer4_4 Fer4_15 Fer4_13
Motif
Other DBs
NCBI-GeneID: 912556
NCBI-ProteinID: NP_310364
UniProt: P58323
Position
2305979..2306557
Genome map
AA seq 192 aa AA seqDB search
MNAIWIAVAAVSLLGLAFGAILGYASRRFAVEDDPVVEKIDEILPQSQCGQCGYPGCRPY
AEAISCNGEKINRCAPGGEAVMLKIAELLNVEPQPLDGEAQELTPARMVAVIDENNCIGC
TKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISLQPVAETPDSWKWDLNT
IPVRIIPVEHHA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctatctggattgccgttgccgccgtgagcctgctgggcctggcgtttggcgcc
attctgggttatgcctcccgccgttttgcggtggaagacgatccggtcgttgagaaaatt
gacgaaatcttaccgcagagccagtgtggtcagtgcggttatcccggctgtcgcccctac
gcggaagccatcagctgtaacggtgaaaaaatcaaccgttgcgcccctggtggcgaagct
gtgatgctaaaaattgccgagttgcttaatgtcgagccgcagccgctggatggcgaagcg
caagagctaacgcctgcgcggatggtggcggttattgatgaaaataactgtattggctgc
actaaatgtattcaggcgtgtccggtagacgccatcgttggcgctacccgtgccatgcat
acggtaatgagtgatctctgtacgggctgcaatttatgtgttgatccgtgcccgacgcac
tgcatctcgttgcaaccggtcgcagaaacacctgactcctggaaatgggatctgaacacc
attcccgtgcgtatcattcccgtggaacaccatgcttaa

DBGET integrated database retrieval system