KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs2489Help
Entry
ECs2489           CDS       T00048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00010  Glycolysis / Gluconeogenesis
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
ecs01120  Microbial metabolism in diverse environments
ecs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECs2489
Enzymes [BR:ecs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ECs2489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 915156
NCBI-ProteinID: NP_310516
UniProt: Q8XDU6
Position
2465452..2466336
Genome map
AA seq 294 aa AA seqDB search
MIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPAGEEEVLW
LSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHREDANGVALTFE
LTQSEETKKFWLHDFTLLAHFRVDKNCEIDLEAHGEFETTSALHTYFNVGDIAKVSVSGL
GDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGHQHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETAYASEMQKVTKEKPAHLAQSIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatttttgcccttccggtcatcgaacaaatctcccctgtcctctcccgt
cgtaaactggatgaactggacctcattgtagtcgatcatccccaggtaaaagcctctttt
gcattacagggcgcacaccttctctcgtggaaacctgcaggtgaagaagaagttctgtgg
ttgagcaacaacacaccgttcaaaaatggcgttgctattcgcggtggcgtaccggtttgc
tggccgtggtttggtccggcggcacaacaaggcctgcctgcgcacggttttgcccgcaac
ctgccgtggacgctgaaatcacatcgtgaagatgctaatggcgtagcgctgacttttgaa
ttgacacaaagcgaagagacgaaaaaattctggctgcacgactttactctgttagcgcat
ttccgcgtggataaaaactgtgaaatcgatcttgaagcacacggcgaatttgaaaccacc
tctgccctgcatacctactttaacgtgggtgatatcgctaaggtaagcgtcagtgggctg
ggcgatcgcttcattgataaagtaaatgacgcgaaagaagatgtactgaccgacggtatt
cagaccttccctgaccgtaccgatcgcgtgtatctgaatccgcaagattgcagcgtgatt
aatgatgaagcgctgaatcgtattatcgccgtaggccaccagcatcatctgaacgttgta
ggctggaacccgggaccggcgctttcagttagcatgggcgacatgccggacgatggctac
aagacctttgtttgtgtagaaacagcttacgcctcagaaatgcaaaaagtgaccaaagaa
aaacctgcacatctggcgcaatccattcgcgttgccaaacgttaa

DBGET integrated database retrieval system