KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs3143Help
Entry
ECs3143           CDS       T00048                                 

Definition
(RefSeq) bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00520  Amino sugar and nucleotide sugar metabolism
ecs01100  Metabolic pathways
ecs01503  Cationic antimicrobial peptide (CAMP) resistance
Module
ecs_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ECs3143
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ECs3143
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ecs01005]
    ECs3143
Enzymes [BR:ecs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     ECs3143
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     ECs3143
Lipopolysaccharide biosynthesis proteins [BR:ecs01005]
 Unusual sugar
  ECs3143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C 3Beta_HSD NAD_binding_10 NAD_binding_4 RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 916851
NCBI-ProteinID: NP_311170
UniProt: Q8XDZ3
Structure
PDB: 

Position
3098552..3100534
Genome map
AA seq 660 aa AA seqDB search
MKTVVFAYHDMGCLGIEALLAAGYEISAIFTHTDNPGEKAFYGSVARLAAERGIPVYAPD
NVNHPLWVERIAQLSPEVIFSFYYRHLICDEILQLAPAGAFNLHGSLLPKYRGRAPLNWV
LVNGETETGVTLHRMVKRADAGAIVAQLRVAIAPDDIAITLHHKLCHAARQLLEQTLPAI
KHGNILEIAQRENEATCFGRRTPDDSFLEWHKPASVLHNMVRAVADPWPGAFSYVGNQKF
TVWSSRVHPHASKAQPGSVISVAPLLIACGDGALEIVTGQAGDGITMQGSQLAQTLGLVQ
GSRLNSQPACTARRRTRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHP
HFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYC
VKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEK
EGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDI
RDGIEALYRIIENAGNRCDGEIINIGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGF
RVVESSSYYGKGYQDVEHRKPSIRNAHHCLDWEPKIDMQETIDETLDFFLRTVDLTDKPS
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgtcgtttttgcctaccacgatatgggatgcctcggtattgaagccctgctg
gctgccggttacgaaattagcgccatttttacccataccgataatcccggtgaaaaagcc
ttttatggttcggtggctcgtctggcggcggaaagaggcattccggtttatgcgccggat
aacgttaatcatccgctgtgggtggaacgcattgcccaactctcaccagaggtgattttc
tctttttattatcgccatcttatttgcgacgagattttgcagctcgctcccgcaggtgca
tttaatctgcacggttcgctgttaccaaaatatcgtggtcgcgcgccgctgaactgggtg
ctggtgaacggtgaaacagaaactggcgttacattgcaccgaatggtaaaacgtgccgat
gccggggccattgtggcgcaactgcgcgttgccattgcgccagacgatatcgctattacg
ctgcatcataaattgtgccatgccgcgcgccagctactggaacagacattacccgccatt
aaacacggtaatattctggaaatcgcccagcgcgaaaacgaagccacctgttttggtcgc
agaacgccggatgacagtttcctcgaatggcataagccggcatccgtactgcacaacatg
gtacgtgccgttgccgatccgtggccgggtgccttcagctatgttggcaatcagaaattc
accgtctggtcgtcgcgtgttcatcctcatgccagcaaagcacagccggggagcgtgatt
tctgttgcgccactgctgattgcctgtggcgatggcgcgctggaaatcgtcaccggacaa
gcgggcgacggcattactatgcagggctcgcaattagcgcagacgctgggcctggtgcaa
ggttcacgcttgaatagccagcctgcctgcaccgcccgacgccgtacccgggtactcatc
ctcggggtgaatggctttattggcaaccatctgacagaacgcctgctgcgcgaagatcat
tatgaagtttacggtctggatattggcagcgatgcgataagccgttttctgaatcatccg
cattttcactttgtcgaaggcgatatcagtattcattccgaatggattgagtatcacgtc
aaaaaatgtgatgtcgtcttgccgctggtggcgatagccacgccgattgaatatacccgc
aacccgctgcgcgtatttgaactcgattttgaagagaatctgcgcattatccgctactgc
gtgaagtaccgtaagcgaatcatcttcccgtcaacttcagaagtttatgggatgtgtagc
gataaatacttcgatgaggaccattctaatttaatcgtcggcccggtgaataaaccacgc
tggatttattcggtatcaaaacaattacttgatcgggtgatctgggcctatggcgaaaaa
gagggtttacagttcaccctcttccgcccgtttaactggatgggaccacgactggataac
cttaatgcggcacgaatcggcagctcccgcgcgattacgcaactcattctcaatctggta
gaaggttcaccgattaagctgattgatggcggaaaacaaaaacgctgctttactgatatt
cgcgatggtatcgaggcgttataccgcattatcgaaaatgcgggaaatcgctgcgacggc
gaaattatcaacattggcaatcctgagaacgaagcgagcattgaggaactgggcgagatg
ctgctggcgagcttcgaaaaacatccgctgcgccatcatttcccaccgtttgcgggcttt
cgcgttgtcgaaagtagcagctactacggcaaaggatatcaggacgtagagcatcgtaaa
ccgagcatccgcaatgcccaccactgcctggactgggagccgaaaattgatatgcaggaa
accatcgacgaaacgctggatttcttcctgcgcaccgttgatcttacggataaaccatca
tga

DBGET integrated database retrieval system