KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs3195Help
Entry
ECs3195           CDS       T00048                                 

Definition
(RefSeq) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00130  Ubiquinone and other terpenoid-quinone biosynthesis
ecs00627  Aminobenzoate degradation
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
ecs01120  Microbial metabolism in diverse environments
ecs01220  Degradation of aromatic compounds
Module
ecs_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ECs3195
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ECs3195
Enzymes [BR:ecs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     ECs3195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 916903
NCBI-ProteinID: NP_311222
UniProt: P0AG04
Position
complement(3154228..3154797)
Genome map
AA seq 189 aa AA seqDB search
MKRLIVGISGASGAIYGVRLLQVLRDVTDIETHLVMSQAARQTLSLETDFSLREVQALAD
VTHDARDIAASISSGSFQTLGMVILPCSIKTLSGIVHSYTDGLLTRAADVVLKERRPLVL
CVRETPLHLGHLRLMTQAAEIGAVIMPPVPAFYHRPQSLDDVINQTVNRVLDQFAITLPE
DLFARWQGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacttattgtgggcatcagcggtgccagcggcgcgatttatggtgtgcgctta
ttacaggttctgcgcgatgtcacagatatcgaaacgcatctggtaatgagccaggcggcg
cgccagaccttatccctcgaaacggatttttccctgcgcgaagtgcaggcattagctgat
gtcacgcatgatgcgcgcgatattgccgccagcatctcttccggttctttccagacactg
gggatggtgattttaccctgttcaatcaaaaccctgtccggcattgtccatagctatact
gatggcttactgacccgtgcggcagatgtggtgctgaaagagcgtcgcccactggtgctc
tgcgtgcgtgaaacaccattgcacttaggccatctgcgtttaatgacgcaggcagcagaa
atcggtgcggtgattatgcctcccgttccggcgttttatcatcgcccgcaatcccttgat
gatgtgataaatcagacggttaatcgtgttcttgaccagtttgcgataacccttcctgaa
gatctctttgcccgctggcagggcgcataa

DBGET integrated database retrieval system