KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs3243Help
Entry
ECs3243           CDS       T00048                                 

Definition
(RefSeq) sucrose-6 phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00052  Galactose metabolism
ecs00500  Starch and sucrose metabolism
ecs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECs3243
   00500 Starch and sucrose metabolism
    ECs3243
Enzymes [BR:ecs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECs3243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 915657
NCBI-ProteinID: NP_311270
UniProt: A0A0H3JGP6
Position
3204424..3205857
Genome map
AA seq 477 aa AA seqDB search
MTQSRLHAAQNALAKLHERRGNTFYPHFHLAPPAGWMNDPNGLIWFNDRYHAFYQHHPMS
EHWGPMHWGHATSDDMIHWQHEPIALAPGDENDKDGCFSGSAVDDNGVLSLIYTGHVWLD
GAGNDDAIREVQCLATSRDGIHFEKQGVILTPPEGIMHFRDPKVWREADTWWMVVGAKDP
GNTGQILLYRGSSLREWTFDRVLAHADAGESYMWECPDFFSLGDQHYLMFSPQGMNAEGY
SYRNRFQSGVIPGMWSPGRLFAQSGHFTELDNGHDFYAPQSFVAKDGRRIVIGWMDMWES
PMPSKREGWAGCMTLARELSESNGKLLQRPVHEAESLRQQHQSISPRTISNKYVLQENAQ
AVEIQLQWALKNSDAEHYGLQLGTGMRLYIDNQSERLVLWRYYPHENLDGYRSIPLPQRD
TLALRIFIDTSSVEVFINDGEAVMSSRIYPQPEERELSLYASHGVAVVQHGALWQLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatctcgattgcatgcggcgcaaaacgcactagcaaaacttcacgagcgccga
ggtaacactttctatccccattttcacctcgcgcctcctgccgggtggatgaacgatcca
aacggcctgatctggtttaacgatcgttatcacgcgttttatcaacatcacccaatgagt
gaacactgggggccaatgcactggggacatgccaccagcgacgatatgatccactggcag
catgagcctattgcgctagcgccaggagacgagaatgacaaagatgggtgtttttcaggt
agtgctgtcgatgacaatggtgtcctctcacttatctacaccggacacgtctggctcgat
ggtgcaggtaatgacgatgcaattcgcgaagtacaatgtctggctaccagtcgggatggt
attcatttcgagaaacagggtgtgatcctcactccaccagaaggaatcatgcacttccgc
gatcctaaagtgtggcgtgaagccgacacatggtggatggtagtcggggcgaaagaccca
ggcaacactgggcagatcctgctttatcgcggcagttcattacgtgaatggactttcgat
cgcgtactggcccacgctgatgcgggtgaaagctatatgtgggaatgtccggactttttc
agccttggcgatcagcattatctgatgttttccccgcagggaatgaatgccgagggatac
agttaccgaaatcgctttcaaagtggcgtaatacccggaatgtggtcgccaggacgactt
tttgcacaatccgggcattttactgaacttgataacgggcatgacttttatgcaccacaa
agctttgtagcgaaggatggtcggcgtattgttatcggctggatggatatgtgggaatcg
ccaatgccctcaaaacgtgaaggctgggcaggctgcatgacgctggcgcgcgagctatca
gagagcaatggcaaacttctacaacgcccggtacacgaagctgagtcgttacgccagcag
catcaatctatctctccccgcacaatcagcaataaatatgttttgcaggaaaacgcgcaa
gcagttgagattcagttgcagtgggcgctgaagaacagtgatgccgaacattacggatta
cagctcggcactggaatgcggctgtatattgataaccaatctgagcgacttgttttgtgg
cggtattacccacacgagaatttagacggctaccgtagtattcccctcccgcagcgtgac
acgctcgccctaaggatatttatcgatacatcatccgtggaagtatttattaacgacggg
gaagcggtgatgagtagtcgaatctatccgcagccagaagaacgggaactgtcgctttat
gcctcccacggagtggctgtggtgcaacatggagcactctggcaactgggttaa

DBGET integrated database retrieval system