KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs3361Help
Entry
ECs3361           CDS       T00048                                 

Definition
(RefSeq) phosphoribosylaminoimidazole synthetase
  KO
K01933  phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00230  Purine metabolism
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
ecs01130  Biosynthesis of antibiotics
Module
ecs_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECs3361
Enzymes [BR:ecs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     ECs3361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 915220
NCBI-ProteinID: NP_311388
UniProt: Q8XAC5
Structure
PDB: 

Position
3337340..3338377
Genome map
AA seq 345 aa AA seqDB search
MTDKTSLSYKDAGVDIDAGNALVGRIKGVVKKTRRPEVMGGLGGFGALCALPQKYREPVL
VSGTDGVGTKLRLAMDLKRHDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAS
AVISGIAEGCLQSGCSLVGGETAEMPGMYHGEDYDVAGFCVGVVEKSEIIDGSKVSDGDV
LIALGSSGPHSNGYSLVRKILEVSGCDPQTTELDGKPLADHLLAPTRIYVKSVLELIEKV
DVNAIAHLTGGGFWENIPRVLPDNTQAVIDESSWQWPEVFNWLQTAGNVERHEMYRTFNC
GVGMIIALPAPEVDKALALLNANGENAWKIGIIKASDSEQRVVIE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgataaaacctctcttagctacaaagatgccggtgttgatattgacgcgggtaat
gctctggttggaagaatcaaaggcgtagtgaagaaaacgcgtcgtccggaagtgatgggc
ggtctgggcggcttcggtgcgctgtgtgcattgccgcaaaaatatcgtgaacccgtgctg
gtttccggcactgacggcgtaggtaccaagctgcgtctggcaatggacttaaaacgtcac
gacaccattggtattgatctggtcgccatgtgcgttaatgacctggtggtgcaaggtgca
gaaccgctgtttttcctcgactattacgcaaccggaaaactggatgttgataccgcttca
gcggtgatcagcggcattgcggaaggttgtctgcaatcgggctgttcactggtgggtggc
gaaacggcagaaatgccggggatgtatcacggtgaggattacgatgtcgcgggtttctgc
gtgggcgtggtagaaaaatcagaaatcatcgacggctctaaagtcagcgacggcgatgtg
ctgattgcactcggttccagcggtccgcactcgaacggctattcgctggtgcgcaaaatt
cttgaagtcagcggttgtgatccgcaaaccaccgaacttgatggtaagccattagccgat
catctgctggcaccgacccgcatttacgtgaagtcagtgctggagttgattgaaaaggtc
gatgttaatgccattgcgcacctgaccggcggcggcttttgggaaaacattccgcgcgta
ttgccagataatacccaggcagtgattgatgaatcctcctggcagtggccggaagtgttc
aactggctgcaaacggctggtaacgttgagcgccatgaaatgtatcgcaccttcaactgc
ggcgtcgggatgattattgccctgcctgctccggaagtggacaaagccctcgccctgctc
aatgccaacggtgaaaacgcgtggaaaatcggtatcatcaaagcctctgattccgaacaa
cgcgtggttatcgaataa

DBGET integrated database retrieval system