KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs3606Help
Entry
ECs3606           CDS       T00048                                 

Definition
(RefSeq) sulfate adenylyltransferase subunit 2
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00230  Purine metabolism
ecs00261  Monobactam biosynthesis
ecs00450  Selenocompound metabolism
ecs00920  Sulfur metabolism
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
ecs01120  Microbial metabolism in diverse environments
ecs01130  Biosynthesis of antibiotics
Module
ecs_M00176  Assimilatory sulfate reduction, sulfate => H2S
ecs_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ECs3606
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECs3606
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECs3606
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ECs3606
Enzymes [BR:ecs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     ECs3606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct
Motif
Other DBs
NCBI-GeneID: 914672
NCBI-ProteinID: NP_311633
UniProt: Q8X7X4
Position
complement(3595944..3596852)
Genome map
AA seq 302 aa AA seqDB search
MDQIRLTHLRQLEAESIHIIREVAAEFSNPVMLYSIGKDSSVMLHLARKAFYPGTLPFPL
LHVDTGWKFREMYEFRDRTAKAYGCELLVHQNPEGVAMGINPFVHGSAKHTDIMKTEGLK
QALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWHNYNGQINKGES
IRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMIDDNRIDLQPGEVIK
KRMVRFRTLGCWPLTGAVESNAQTLPEIIEEMLVSTTSERQGRVIDRDQAGSMELKKRQG
YF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaatacgacttactcacctgcggcaactggaggcggaaagcatccacattatt
cgcgaggtggcggcagaattctcaaatccggtgatgctctactctatcggtaaagattcc
agcgtcatgctgcatctggcgcgcaaggcgttttatccaggtacgctgcctttcccgttg
ctgcatgtcgataccggctggaaattccgtgagatgtatgagttccgcgatcgtacggcg
aaagcctacggctgcgagctgctggtgcatcaaaacccggaaggcgtggcgatggggatt
aatccattcgtgcacggcagcgcgaaacataccgatattatgaagaccgaaggcctgaag
caggcgctgaataaatacggttttgatgccgccttcggtggtgcgcgccgcgacgaagag
aaatcccgtgctaaagagcgtatctactctttccgtgatcgcttccatcgctgggacccg
aaaaatcagcgcccggagctgtggcacaactataacgggcagattaacaaaggcgaaagc
atccgcgttttcccgctctctaactggaccgagcaggatatctggcaatacatctggctg
gaaaatatcgacattgtgccgctgtatctcgctgcggaacgtccggttctggaacgcgac
ggtatgttgatgatgattgatgacaaccgtatcgacctgcaaccgggcgaagtgattaaa
aaacggatggtgcgtttccgtacgctgggctgctggccgctgaccggtgcggtggagtca
aatgcacaaacgctgccggagatcatcgaagagatgctggtttccaccaccagtgaacgt
caggggcgcgtgattgaccgcgaccaagctggttctatggagctgaaaaaacgtcagggg
tatttttaa

DBGET integrated database retrieval system