KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs3741
Entry
ECs3741           CDS       T00048                                 

Definition
(RefSeq) xanthine dehydrogenase subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00230  Purine metabolism
ecs01100  Metabolic pathways
ecs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECs3741
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-GeneID: 916430
NCBI-ProteinID: NP_311768
UniProt: Q8X6C4
Position
3741820..3742299
AA seq 159 aa
MNHSETITIECTINGMPFQLHAVPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
catgccgtaccaggcacgccgctctcggaattactccgcgaacaagggctgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system