KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs5206Help
Entry
ECs5206           CDS       T00048                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECs5206
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecs02000]
    ECs5206
Enzymes [BR:ecs01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     ECs5206
Transporters [BR:ecs02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    ECs5206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_30 ABC_ATPase AAA_16 AAA_23 RsgA_GTPase AAA_22 MMR_HSR1 AAA_15 DUF2813 TsaE DUF815 DLIC FeoB_N
Motif
Other DBs
NCBI-GeneID: 913896
NCBI-ProteinID: NP_313233
UniProt: P63299
Position
5306538..5308040
Genome map
AA seq 500 aa AA seqDB search
MTTDQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYH
ADRGTIWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKRFGLLRRK
EMEKRATELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQE
VELLFDLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETCELPQIELVKM
MLGRELDTHALQRAGRTLLSDKPVAAFKNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRT
ETAEVIFGIKPADSGTALIKGKPQNLRSPHQASVLGIGFCPEDRKTDGIIAAASVRENII
LALQARRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRWLLTR
PQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRKQ
VAEIPLAELSVPAIMNAIAA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgaccaacaccaggagatcctccgcaccgaaggattaagtaaatttttcccc
ggcgtcaaagcgttagacaacgttgatttcagcctgcgccgtggcgaaatcatggcgctg
ctcggtgaaaacggggcgggaaaatcaacgctaatcaaagcattaactggtgtataccac
gctgatcgcggcaccatctggctggaaggccaggctatctcaccgaaaaataccgcccac
gcgcaacaactcggcattggcaccgtctatcaggaagtcaacctgctacccaatatgtcg
gtcgctgataatctatttataggccgcgaacccaaacgcttcggccttctacgccgcaaa
gagatggaaaagcgcgccaccgaactgatggcatcttacggtttctccctcgacgtgcgc
gaaccgctcaaccgcttttcagtcgcgatgcagcaaatcgtcgctatttgccgggctatc
gatctctctgccaaagtgctgatcctcgatgaacccaccgccagtctcgacacccaggaa
gtggagttactgtttgacctgatgcgtcagttgcgcgatcgcggcgtcagcctgatcttt
gtcactcactttctcgatcaggtctatcaggtcagcgatcggatcaccgtcttacgcaac
ggcagtttcgtaggctgtcgggaaacgtgcgagctaccgcagatcgaactggtaaaaatg
atgctggggcgcgagctggatacccacgcgctacagcgtgccgggcgaacattgttgagc
gacaaacccgttgccgcgttcaaaaattacggcaaaaaaggaacgatcgcaccgtttgat
ctcgaagtacgccccggcgagatcgtcggtctggctggattgctgggatcaggacgtacc
gaaaccgccgaagtgatcttcggtatcaaacctgctgacagcggcacggcgttgatcaaa
ggcaaaccgcaaaacctgcgatcgccacatcaggcttcggtacttggcattggcttctgc
ccggaagacaggaaaaccgatggcatcatcgctgccgcctcggtgcgggaaaatatcatc
ctcgctctccaggcccggcgcggctggctacgtcccatttcccgcaaagaacagcaagag
attgccgaacgctttatccgccagcttggcattcgcacaccttcaactgaacaaccgatt
gaatttctctccggcggcaatcagcaaaaagtgttgctttcacgttggctactgacccga
ccgcaatttctgatcctcgatgagccaacccgcggcattgatgttggtgcccacgccgag
atcatccgcctgattgaaacgctatgcgccgatggtctggcgctgctggtgatctcctcc
gaactggaagaactggtgggctatgccgaccgggtgatcatcatgcgcgatcgcaaacag
gtggcggagatcccgctggcagagctttccgttccggcgatcatgaatgccattgcggcg
taa

DBGET integrated database retrieval system