KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0077Help
Entry
ECIAI39_0077      CDS       T00829                                 

Gene name
leuC
Definition
(RefSeq) isopropylmalate isomerase large subunit
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00290  Valine, leucine and isoleucine biosynthesis
ect00660  C5-Branched dibasic acid metabolism
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01210  2-Oxocarboxylic acid metabolism
ect01230  Biosynthesis of amino acids
Module
ect_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    ECIAI39_0077 (leuC)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ECIAI39_0077 (leuC)
Enzymes [BR:ect01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     ECIAI39_0077 (leuC)
    4.2.1.35  (R)-2-methylmalate dehydratase
     ECIAI39_0077 (leuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Spo0M
Motif
Other DBs
NCBI-GeneID: 7151927
NCBI-ProteinID: YP_002406125
UniProt: B7NHI0
Position
complement(89689..91089)
Genome map
AA seq 466 aa AA seqDB search
MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLRAHGRPVRQPGKTFAT
MDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPYQGIVHVMGPEQGVTLP
GMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRAKTMKIEVQGKAAPGITA
KDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNMAIEMGAKAGLVAPDETTF
NYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQAEEISPQVTWGTNPGQVISV
NDNIPDPASFADPVERASAEKALAYMGLKPGIPLTEVAIDKVFIGSCTNSRIEDLRAAAE
IAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNP
GERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGHFADIRNIK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggctaagacgttatacgaaaaattattcgacgctcacgtagtgtacgaagccgaaaac
gaaaccccgctgttatatatcgaccgccacctggtgcatgaagtgacctcaccgcaggcg
ttcgatggtctgcgcgcccacggtcgcccggtacgtcagccggggaaaaccttcgccacc
atggatcacaacgtctctactcagaccaaagacattaatgcctgcggtgaaatggcgcgc
atccagatgcaggagctgatcaaaaactgcaaagaatttggcgtcgagctgtatgacctg
aatcacccgtatcaggggatcgtccacgtaatggggccggaacagggcgtcacattgccg
gggatgaccattgtctgcggcgactcacataccgccacccacggcgcgtttggcgcactg
gcctttggtatcggcacttccgaagttgaacacgtactggcaacgcaaaccctgaaacag
ggtcgtgcgaagaccatgaaaattgaagtccagggcaaagccgcgccgggcattaccgcg
aaagatatcgtgctggcgattatcggtaaaactggtagcgcaggcggcaccgggcatgtg
gtggagttttgcggcgaagcaatccgtgatttaagcatggaaggtcgtatgaccctgtgc
aatatggcaatcgaaatgggcgcgaaagccggtctggttgcaccggacgaaactaccttt
aactatgtcaaaggccgtctgcatgcgccgaaaggcaaagatttcgacgacgccgtcgcc
tactggaaaaccctgcaaaccgacgaaggcgcaactttcgataccgttgtcactctgcaa
gcagaagagatttcgccgcaggtcacctggggcaccaatccaggccaggtgatttccgtg
aacgacaatattcccgatccagcttcgtttgccgatccggttgaacgcgcgtcggcagaa
aaagcgctggcctatatggggctgaaaccgggtattccgctgaccgaagtggctatcgat
aaagtgtttatcggttcctgtaccaactcgcgcattgaagatttacgcgcggcagcggaa
atcgccaaagggcgaaaagtcgcgccaggcgtgcaggcactggtggttcccggctctggc
ccggtaaaagcccaggcggaagcggaaggtctggataaaatttttatcgaagccggtttt
gaatggcgcttgcctggctgctcaatgtgtctggcgatgaataacgaccgtctgaatccg
ggcgaacgttgtgcctccaccagtaaccgtaactttgaaggccgccaggggcgcggcggg
cgcacgcatctggtcagcccggctatggctgccgccgcggctgtgaccggacattttgcc
gacattcgcaacattaaataa

DBGET integrated database retrieval system