KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0680Help
Entry
ECIAI39_0680      CDS       T00829                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00020  Citrate cycle (TCA cycle)
ect00190  Oxidative phosphorylation
ect00650  Butanoate metabolism
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01120  Microbial metabolism in diverse environments
ect01130  Biosynthesis of antibiotics
ect01200  Carbon metabolism
Module
ect_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ect_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ect_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECIAI39_0680 (sdhD)
   00650 Butanoate metabolism
    ECIAI39_0680 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ECIAI39_0680 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-GeneID: 7152815
NCBI-ProteinID: YP_002406706
UniProt: A0A0H3MEF9
Structure
PDB: 

Position
717649..717996
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggattggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggccttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system