KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0752Help
Entry
ECIAI39_0752      CDS       T00829                                 

Gene name
bioF
Definition
(RefSeq) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00780  Biotin metabolism
ect01100  Metabolic pathways
Module
ect_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:ect00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ECIAI39_0752 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ect01007]
    ECIAI39_0752 (bioF)
Enzymes [BR:ect01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     ECIAI39_0752 (bioF)
Amino acid related enzymes [BR:ect01007]
 Aminotransferase (transaminase)
  Class II
   ECIAI39_0752 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 7150863
NCBI-ProteinID: YP_002406777
UniProt: B7NNK6
Structure
PDB: 

Position
793346..794500
Genome map
AA seq 384 aa AA seqDB search
MSWQDKINAALDARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIR
AWKLGAEQFGVGSGGSGHVSGYSVAHQVLEEELAEWLGYSRALLFISGFAANQAVIAAMM
AKEDRIVADRLSHASLLEAASLSPSPLRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSM
DGDSAPLEEIQQVTQQHDGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVVTFGKGFGV
SGAAVLCSNTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLVSLIA
RFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARL
RLTLTAAHEMQDIDRLLEVLHGND
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaggataaaatcaacgcggcgctcgatgcgcggcgtgctgccgatgccctg
cgtcgccgttatccggtggcgcaaggggccggacgctggctggtggcggatgatcgccag
tatctgaacttttccagtaacgattatttaggtttaagccatcatccgcaaattatccgt
gcctggaagctgggggcggaacaatttggtgtcggtagcggcggttccggtcacgtcagc
ggttatagcgtggcgcaccaggtgctggaagaagaactggccgagtggcttggctattcg
cgggcactgctgtttatctctggttttgctgctaatcaggccgtcattgccgcgatgatg
gcgaaagaggaccgtattgttgccgaccggcttagccatgcctcattgctggaggctgca
agtttaagcccgtcgccgcttcgccgttttgctcataacgatgtcactcatctggcgcga
ctgcttgcttccccctgtccggggcagcaactggtagtgacagaaggcgtgttcagcatg
gacggcgatagtgcgccactggaggaaatccagcaggtaacgcaacagcacgatggctgg
ttgatggtcgatgacgcccacggcacgggcgttatcggggagcaggggcgtggcagctgc
tggctgcaaaaggtaaaaccagaattgctggtggtgacttttggcaaaggatttggcgtc
agcggagcagcggtgctttgctccaatacggtggcggattatctgctgcaattcgcccgc
catcttatctacagcaccagtatgccgcccgctcaggcgcaggcattacgtgcgtcgctg
gcggtcattcgcagtgatgagggtgatgcacggcgcgaaaaactggtgtcactcattgcg
cgttttcgtgccggagtacaggatttgccgtttacgcttgctgattcatgcagcgccatc
cagccattgattgttggtgataacagccgtgcgttacaactggcagaaaaactgcgccag
caaggctgctgggtcacggcgattcgcccgccaaccgtacctgctggtactgcgcgactg
cgcttaacactaaccgccgcgcatgaaatgcaggatatcgaccgtctgctggaggtgctg
catggcaacgattaa

DBGET integrated database retrieval system