KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0851Help
Entry
ECIAI39_0851      CDS       T00829                                 

Gene name
ltaE
Definition
(RefSeq) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00260  Glycine, serine and threonine metabolism
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01120  Microbial metabolism in diverse environments
ect01130  Biosynthesis of antibiotics
ect01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ect00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECIAI39_0851 (ltaE)
Enzymes [BR:ect01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ECIAI39_0851 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 CheD
Motif
Other DBs
NCBI-GeneID: 7153390
NCBI-ProteinID: YP_002406875
UniProt: A0A0H3MFJ8
Structure
PDB: 

Position
complement(896329..897330)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKI
KPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIY
ALKNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL
INASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgagccgcgccatgctcgaagcaatg
atggccgccccggttggggacgacgtttacggagacgaccctaccgttaatgctctgcag
gactatgcggcagagctttccggtaaagaagccgccatttttctgccgaccggcacccag
gctaacctggtcgctctgctcagtcactgcgaacgcggcgaagagtatattgtcggtcag
gccgcacacaactatctgtttgaagccggtggcgcagcggtgctgggcagtattcaaccg
caacccatcgacgcggctgccgacggcacgctaccgctggataaagtggcgatgaaaatc
aaacccgacgatatccatttcgcccgcaccaaattactcagtctggaaaacactcacaac
ggcaaagtgctgccgcgtgaatacctcaaagaagcatgggaatttacccgcgagcgcaat
ctggcactgcatgtggacggtgcgcgcatctttaatgctgtggtggcttacggctgcgaa
ctgaaagagatcacacaatattgtgattcgttcaccatttgcctgtcgaaaggtcttggg
acgccagtcggttcattactcgtcggtaatcgtgattacattaaacgtgccattcgctgg
cggaaaatgacaggtggcgggatgcgccagtccggcattctggctgccgccggaatatat
gccctgaaaaataacgttgcgcgcttgcaggaagaccacgacaacgctgcctggatggcg
gagcagctgcgtgaagcaggcgcggatgtgatgcgtcaggacaccaatatgctgtttgtt
cgcgtcggggaagaaaatgctgccgcgttaggcgaatacatgaaagcgagaaacgtgctg
attaacgcctcgccgattgtccgcctggtgacgcatcttgacgtctcgcgcgctcagctg
gcggaagtcgccgcccactggcgcgcattcctggcgcgttaa

DBGET integrated database retrieval system