KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1439Help
Entry
ECIAI39_1439      CDS       T00829                                 

Gene name
hdhA
Definition
(RefSeq) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ect00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    ECIAI39_1439 (hdhA)
Enzymes [BR:ect01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     ECIAI39_1439 (hdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N THF_DHG_CYH_C MccV AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 7151809
NCBI-ProteinID: YP_002407444
UniProt: A0A0H3MG69
Structure
PDB: 

Position
1510644..1511411
Genome map
AA seq 255 aa AA seqDB search
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGG
QAFAWRCDITSEQELSALADFAVSKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVF
SFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEK
NIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVS
GQILTVSGGGVQELN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaattctgacaacctgagactcgacggaaaatgcgccatcatcacaggtgccggt
gcaggtattggtaaagaaattgccattacattcgcgacagctggcgcatctgtggtggtc
agtgatattaacgccgacgcagctaaccatgttgtagatgaaattcaacaactgggtggt
caggcatttgcctggcgttgtgatattacttccgaacaggaactctctgcactggcagac
tttgccgtcagtaagctgggtaaagttgatattctggttaacaacgccggtggcggtggt
cctaaaccatttgatatgccaatggcagattttcgccgtgcttatgaactgaatgtgttt
tcttttttccatctgtcacaacttgttgcgccagaaatggaaaaaaatggcggtggcgtt
attctgactatcacttctatggcggcagaaaataaaaatataaacatgacttcctatgca
tcatctaaagctgcggccagtcatctggtcagaaatatggcatttgacctgggtgaaaaa
aatattcgggtaaatggcattgcgccgggggcaatattaaccgatgccctgaaatccgtt
attacaccagaaattgaacaaaaaatgttacaacacacgccgatcagacgtctgggccaa
ccgcaagatattgctaacgcggcgctgttcctttgctcgcctgcagccagctgggtaagc
ggacaaattctcacggtctccggtggtggggtacaggagctcaattaa

DBGET integrated database retrieval system