KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1742Help
Entry
ECIAI39_1742      CDS       T00829                                 

Gene name
adhP
Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00010  Glycolysis / Gluconeogenesis
ect00071  Fatty acid degradation
ect00350  Tyrosine metabolism
ect00625  Chloroalkane and chloroalkene degradation
ect00626  Naphthalene degradation
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01120  Microbial metabolism in diverse environments
ect01130  Biosynthesis of antibiotics
ect01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECIAI39_1742 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    ECIAI39_1742 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECIAI39_1742 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECIAI39_1742 (adhP)
   00626 Naphthalene degradation
    ECIAI39_1742 (adhP)
Enzymes [BR:ect01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECIAI39_1742 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C Methyltransf_31 Phage_holin_2_1
Motif
Other DBs
NCBI-GeneID: 7149791
NCBI-ProteinID: YP_002407737
UniProt: A0A0H3ML50
Structure
PDB: 

Position
complement(1829970..1830980)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcatgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtgattctgggacacgaaggt
attggtgtggtggcagaagttggcccaggtgtcacttcattaaaaccaggcgatcgtgcc
agcgtggcgtggttttacgaaggatgcggtcattgcgaatactgtaatagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagaa
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggcctggactcggcggcggcc
agcagcattacctgtgcgggggtcaccacctacaaagcggtgaagctgtcaaaaattcgt
ccagggcaatggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcgaagaatgtctttaacgcgaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggcgctgatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaactggtggcgctcacgcagcagtggtgacagcggtagctaaagct
gcgtttaactcggcggtggatgctgtccgtgcaggtggtcgtgtcgtggctgtcggtctg
ccgccggagtctatgagcctggacatcccgcggctggtgctggatggcattgaagtggtc
ggttcgctggtcggcacgcgccaggatttaactgaagccttccagtttgccgccgaaggc
aaagtggtaccgaaggtcgccctgcgtccgttagcggacatcaacacaatctttactgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgctaa

DBGET integrated database retrieval system