KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_2966Help
Entry
ECIAI39_2966      CDS       T00829                                 

Definition
(RefSeq) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00052  Galactose metabolism
ect00500  Starch and sucrose metabolism
ect01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECIAI39_2966
   00500 Starch and sucrose metabolism
    ECIAI39_2966
Enzymes [BR:ect01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECIAI39_2966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-GeneID: 7150101
NCBI-ProteinID: YP_002408895
UniProt: A0A0H3MTD5
Position
3070872..3072281
Genome map
AA seq 469 aa AA seqDB search
MSMPSQMPAILQAVMKGQSKALADAHYPCWHLAPVTGLMNDPNGFCWSGGRYHLFYQWNP
LACDHKYKCWGHWSSTDLLHWQHEPLALMPDKEYDRNGCYSGSAVNNQGVLTLCYTGNVK
FDDGSRTAWQCLATENNQGGFDKLGPVIPLPDGYTGHVRDPKVWKHNSQWYMVLGAQDKE
KRGKVLLYSSVDLYTWSFHGEIAGNGLNEIDNAGYMWECPDFFALDGEYILLCCPQGMVR
EHERYLNTYPCAWLHGQFDYETGKFTHGAFSELDAGFEFYAPQTMEAPDGRRLLVGWMGV
PDGEEMLQPTRKHHWQHQMTCFRELSFQKGKLFQMPIRELAQLREAEHFWQGKADHAPHV
EIERLEMDIIPSGELHLNFGNALALHLNDDGIQLQRKSLAGQEKLTRYWRGSVTSLKILC
DSSSIEIFINNGEGVMSNRYFPHHPASLILQGESDVTLHYWSLRACMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgccttcacaaatgcccgcgattttacaggcagtgatgaaaggtcagtccaaa
gcactggcagatgcccactatccttgttggcatctcgctcccgtcaccggactaatgaac
gatccaaatggcttttgctggtctggaggccgctatcatctgttttatcagtggaatcca
ctggcttgtgatcataagtacaaatgttgggggcactggagttcgacggatttattgcac
tggcagcatgaaccattagcgctaatgcccgataaagagtacgaccgtaatggttgttac
tcaggaagcgcggttaataatcagggcgttctcacactttgctataccggtaatgttaag
tttgatgatggcagcagaacggcatggcaatgcctggccaccgaaaataaccagggcggg
tttgataaactaggccctgtcataccgttacctgatggttacaccggacatgttcgtgat
ccaaaagtctggaagcacaacagccaatggtacatggtgcttggcgcgcaagataaagag
aaacgggggaaagtgctgctgtattcctctgtcgatctctatacctggtcttttcatgga
gaaattgctggtaacggtctgaatgaaatagataacgcaggatacatgtgggaatgtcct
gattttttcgcccttgatggtgaatacattctcctctgttgcccccagggaatggtgcgc
gaacatgagcgctatctgaatacttatccctgcgcctggctacatggacagtttgattac
gagacaggcaaatttacgcatggcgctttctcagagctggatgcgggatttgaattctat
gcaccacagacgatggaagccccggacgggcgacgattgctggtcggctggatgggggtt
cctgatggcgaagagatgttgcaaccaaccagaaagcatcattggcagcatcaaatgacc
tgttttcgcgaactctcattccagaagggaaaattgtttcagatgccaatcagggaactc
gcgcaactgcgtgaagctgaacacttctggcaaggaaaagcagatcatgcgccgcatgtc
gaaattgaacgcctggaaatggacatcattccatcaggcgagctacatctgaattttggc
aacgcactggcactgcatcttaatgacgatggtattcaactacagaggaaaagccttgca
gggcaagagaaactaactcgttactggcgaggaagcgtaacgtcactgaagattctctgt
gacagttccagcatagagatattcatcaataatggcgaaggcgtaatgagcaatcgttat
tttccccatcatccagcttcgctgatattacagggcgagtctgacgtcacgttacactac
tggtcgctacgcgcctgcatggtagaatga

DBGET integrated database retrieval system